KEGG   Solitalea canadensis: Solca_4219Help
Entry
Solca_4219        CDS       T02084                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scn  Solitalea canadensis
Pathway
scn00010  Glycolysis / Gluconeogenesis
scn00020  Citrate cycle (TCA cycle)
scn00620  Pyruvate metabolism
scn01100  Metabolic pathways
scn01110  Biosynthesis of secondary metabolites
scn01120  Microbial metabolism in diverse environments
scn01130  Biosynthesis of antibiotics
scn01200  Carbon metabolism
Module
scn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Solca_4219
   00020 Citrate cycle (TCA cycle)
    Solca_4219
   00620 Pyruvate metabolism
    Solca_4219
Enzymes [BR:scn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Solca_4219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H DUF2118 PYNP_C Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFD09209
UniProt: H8KLQ5
LinkDB All DBs
Position
4906406..4908031
Genome map
AA seq 541 aa AA seqDB search
MAEVVRMPKMSDTMTEGVLAKWHKKVGDKVKSGDVVAEVETDKATMDFESFQEGTLLYIG
VEEGQAVPVDAVIAVLGAEGEDYKAALAAEGGNGKAAAAPAEAKAEAAPAPVQSSAPAVT
PESLGATVIRMPLLSDTMTEGVINKWYKKIGDTIKSDDTIADVETDKATMEVTAYAEGTL
LYIGVEEGKAAKVNDIIAIVGKPGTDVSPLLQAAPAAAPAKEEASAGSTAASATSAPVAE
ASTADANGRVKASPLARKIAEEKGIDLAQVKGSAEGGRIVKKDVETFTPSAAPTAKAATP
GAGATTVAAPAVYGQESFTEVAVTQMRKTIARRLSESLFTAPHFYLTMSIDMDQAMEARK
RINELGTIKISFNDIVLKAVAVALKKHPKVNSSWLGDKIRYNNHVNIGVAVAVEDGLLVP
VVRFADTKSLSTISTEVKEYAQKAKDKKLQPADWEGSTFTISNLGMYGIDQFTAIINPPD
ACILAVGGISQVPVVKNGQVVPGNVMKVTLSCDHRVVDGATGSEFLQTLKGLLEEPLRLL
V
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagtacgcatgccaaaaatgagcgataccatgaccgaaggggtattggct
aaatggcataaaaaagttggtgataaagtaaaatcaggcgacgtagttgctgaggttgaa
accgacaaagctaccatggattttgaatcgttccaggaaggaacattattatacatcgga
gttgaagaaggccaggccgttccggttgatgcagtaattgctgttttgggtgccgaaggt
gaagattacaaagctgcattagctgccgaaggtggaaatggtaaagctgctgctgcacct
gctgaagccaaagctgaagctgccccggctccggttcaaagtagcgctcctgctgtaact
cctgagtctttaggtgctactgtaattcgcatgcctttgttaagtgataccatgactgaa
ggtgttattaacaagtggtacaaaaaaatcggtgatactattaagtcagatgatactatc
gctgatgttgaaaccgataaagctacaatggaagtaactgcttatgcagaaggaacctta
ttatacatcggtgttgaagaaggtaaagctgctaaagtgaatgatattattgcaattgtt
ggtaagccaggaacagatgttagtccgttattacaggctgcgcctgcagctgctcctgct
aaagaagaagctagtgctggatcaacagctgcttctgctacatcagcaccagttgctgaa
gcttcaacagcagacgccaatggtcgtgtaaaagcatctccgttggctcgtaaaattgca
gaagaaaaaggcattgaccttgcccaagtaaagggcagtgcagaaggtggacgcattgtg
aagaaggatgtagagacctttactccttcagcagctcctaccgctaaagcagcaactcct
ggtgctggtgcaactacagttgcagctcctgctgtttatggtcaggaaagctttactgag
gttgctgtaacacaaatgcgcaagacaattgctcgtcgtttgtctgaaagtttattcacc
gctcctcacttctacttaaccatgtctattgatatggatcaggcaatggaagctcgcaag
cgtatcaatgaattaggtactataaaaatctctttcaatgatatcgtattaaaagcggtt
gcagttgcattgaaaaaacaccctaaagtaaattcaagctggttaggagataagatccgt
tataacaaccacgtaaatattggtgtagctgtagctgttgaagatggcttgttagtaccg
gttgttcgttttgctgatactaaatcattgtcaactatctctactgaagtaaaagaatac
gctcaaaaagcaaaagataaaaaattgcaaccagctgattgggaaggctcaacctttacc
atttctaacttaggtatgtacggtattgatcagtttactgcgatcattaacccacctgat
gcttgtatcttagcggttggtggtatcagccaggttccggttgttaaaaatggacaagtt
gttcctggtaatgtaatgaaagttactttatcttgtgatcaccgagttgttgatggtgct
actggttcagagttcttacaaacgttaaaaggtttactagaagaaccattgagactttta
gtgtaa

DBGET integrated database retrieval system