KEGG   Streptomyces coelicolor: SCO5254Help
Entry
SCO5254           CDS       T00085                                 

Gene name
2SC7G11.16c, sodN
Definition
(RefSeq) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCO5254 (2SC7G11.16c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SCO5254 (2SC7G11.16c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-GeneID: 1100695
NCBI-ProteinID: NP_629400
Kitasato: SCO5254
UniProt: P80735
LinkDB All DBs
Structure
PDB: 

Position
complement(5714262..5714657)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVTVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcacggtcagcgcccactgcgacctgccctgc
ggcgtgtacgaccctgcccaggcccgcatcgaggcggagtcggtgaaggccgtccaggag
aagatggccggcaacgacgacccgcacttccagacgcgcgccacggtcatcaaggagcag
cgcgccgagctcgcgaagcaccacgtctccgtgctgtggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctgtcg
gccgccaagggctcgaaggacccggcgaccggccagaaggccctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system