KEGG   Streptomyces coelicolor: SCO5308Help
Entry
SCO5308           CDS       T00085                                 

Gene name
SC6G9.25
Definition
(RefSeq) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SCO5308 (SC6G9.25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sco03400]
    SCO5308 (SC6G9.25)
Enzymes [BR:sco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCO5308 (SC6G9.25)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SCO5308 (SC6G9.25)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1100748
NCBI-ProteinID: NP_629450
Kitasato: SCO5308
UniProt: Q9XAF7
LinkDB All DBs
Position
complement(5780326..5781207)
Genome map
AA seq 293 aa AA seqDB search
MAPMTEVEGRRVALSNLDKVLYPAAGLTKGELLHYYATTAEVLLPHLRDRAVSFLRYPDG
PDGQVFFTKNVPPGTPDWVTTAEVPRSEGPARMVLVQDLASLMWAANLVTEFHTHQWTVD
DPGEADRLVFDLDPGPPATVVQCCEVALWLRERLAADGIEAYAKTSGAKGLHLLAGVRGA
SSERVSEYAKGLAVEAERALPELVVHRMTRSLRPGKVFVDWSQNAARKTTAAPYTVRARG
VPAVSTPVTWEEVAGCGRAERFVFLTPDVGRRVRDHGDLLAPLFDRRRAAALP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgatgacggaagtggaggggcggcgggtggccctcagcaacctggacaaggtg
ctgtatcccgcggccggcctcaccaagggcgagctgctgcactactacgcgacgaccgcc
gaggtgctgctgccgcacctgcgggaccgcgcggtctccttcctgcggtatccggacggc
ccggacggccaggtgttcttcaccaagaacgtgccgcctggtacgcccgactgggtcacc
acggccgaggtgccccgctcggagggcccggcccggatggtgctggtgcaggacctggcg
agcctgatgtgggcggcgaacctggtgaccgagttccacacccaccagtggaccgtggac
gatcccggcgaggccgaccggctggtgttcgacctggacccggggccgcccgcgaccgtg
gtgcagtgctgcgaggtcgcgctgtggctgcgggagcggctggcggcggacgggatcgag
gcgtacgccaagacctccggggccaaggggctgcacctgctggcgggggtgcggggcgcg
tcctcggagcgggtgtcggagtacgcgaaggggctcgccgtggaggcggagcgggcgctg
ccggagctggtggtgcaccggatgacgcgcagcctgcggcccgggaaggtgttcgtggac
tggagccagaacgccgcccgcaagaccacggccgccccgtacaccgtgcgcgcccgcggc
gtgcccgcggtctccacgccggtgacgtgggaggaggtcgccgggtgcgggcgggcggag
cggttcgtcttcctgacgccggacgtcggacggcgggtgcgggaccacggcgacctgctg
gccccgctgttcgaccggcggcgggcggcggcgctgccctga

DBGET integrated database retrieval system