KEGG   Streptomyces coelicolor: SCO6275Help
Entry
SCO6275           CDS       T00085                                 

Gene name
SC1G7.01c, SC2C4.05c
Definition
(RefSeq) type I polyketide synthase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Thiolase_N Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 1101716
NCBI-ProteinID: NP_733695
Kitasato: SCO6275
UniProt: Q8CJN6
LinkDB All DBs
Position
complement(6918286..6931959)
Genome map
AA seq 4557 aa AA seqDB search
MVTSENNSVAAGAHTGQVERIAVVGLSCRLPGAADPAAFWELLHSGSDAVTEVPPGRWDV
PADAAPGSGSGGRRGAFLDGVDRFDAGFFGISPREAAAMDPQQRLVLELTWEALEDAAIV
PASLRGSRTAVFVGTLRDDYTNLLYQYGDEAVTQHTMAGVNRGVIAGRVSYHLGLRGPSL
TVDSAQSSSLVAVHLACESLRSGESTTAVVAGVNLNLLAENATTEERFGALSPDGVSYTF
DARANGFVPGEGGGVVVLKPLSAALADGNRIHGVIRGTAVNNDGAADGLTVPSGTAQEQL
IREAHRRSALGPGERVQYVELHGTGTPVGDPVEAAALGAALGAERGDADGPLRVGSVKTN
IGHLEGAAGMAGLIKTLLAITHRELPASLNFRTANPAIPLAELGLEVQRELSAWPRPDRP
LVAGVSSFGMGGTNAHVVVGEPPLPAAEPDTLTGSAAPSSLSWVVTANSEEALRGQAARL
AEFAGAENAPDPRDTGYSLATDRTVFEHRAVVVGADGAALLDGVRALAEGRPGAGVVRGR
GEAGATALLFTGQGAQRPGMGQELYAAHPVFADAFDAVAERLDPMLKQPLWEVIASGEGL
DETGRTQPALFAIEVALFRLLESWGVRPGFLAGHSIGELAAAHVAGVLSLDDAARLVAAR
ARLMQALPAGGAMIAVEATEEEVLPHLEGLEARLSLAAVNGPASVVISGEADAAEDVAAR
LAEAGRRTKRLTVSHAFHSPLMDGMLKEFHKVAKELTYHAPRIPVVSTLTGALASGDDLR
TPCYWTDQVRHAVRFADAVRTLGELGATVLLEVGPDAVLSSLADATPTLRAGRPETRTLL
TAVATAFVRGADVDWRAVHADAGGRSVPLPTYAFQRRRHWFDAAARKETRAIAPAADEVR
SPAAASGVPSVPAGRAERLRYAEDLVTSHVTAVLEYGDGERLDPRVPFQKLGFTSLMTTE
LRAALAEATGLALPGSLLFDHPTPRELTAFLATRLADTTDEPEAGEEFIRPADAGEPIAI
VGMACRFPGGITSPAQLWKLVSEGGDAITEFPVNRGWPDDLYDADPDRPGRSAVRHGGFL
HDAGEFDADFFGISPREALAMDPQQRLLLESAWEAVERAGIDPDTLRGSRTGVFVGATAL
EYGPRMHEAPESVQGSVLTGSTTSVMSGRIAYQLGLLGPAVTTDTACSSSLVALHLAIRS
LRSGETSLALAGGATVMSSPGMFVEFSRQRGLAPDGRCKSFAAGADGTGWSEGVGLLLVE
RLSDARRNGHQVLAVVRGSAVNQDGASNGLTAPNGLSQQRVVRQALADSGLAATEVDAVE
AHGTGTRLGDPIEAEALMATYGTGRDGLPPVYLGSLKSNIGHAQAAAGVGGVIKMVEAIR
HGVLPRTLHVDEPSPRVDWNAGALELLTGERAWPDTGRPRRAAVSSFGISGTNAHVVLEQ
APDAPPPSAAPPATQAPAVPAPWLLSARDPDTLRAQAERLRAYADGDRAPEPAAIGRALA
TTRTAFEQRAVVLAEDRAGYLAGLDALIRGADAPGVVTGSARSAGRTAFLFTGQGAQRAG
MGRELYARHPVFAEALDAAFGALDAHLDLPLREVVFAAEGSREAALLDETTYTQPALFAL
EVALFRLLEHHGVTPGLLAGHSVGELSAAHAAGVLTLDDAAKLVAARGRLMQAARSGGAM
IAVEAAEEEVLPYLEGRAAGLSVAAVNGPASVVISGDEEPALEVAELLRASGRRTKRLTV
SHAFHSPHMDGVLDAFREVASTVAFSAPTVPIVSTVTGRLATEAELTSPQYWANQIRAAV
RFLDAARELAAQGATVFVEAGPDAVLTALTRAALEDTGATAVPLMRAGRPEAETLTLGLG
GAHAAGAALDAATFFPGAATADGLPTYAFRRTHYWLAPASPTDARSLGLDASEHPLLSTS
VELAGREDTLFTGRLSLSGHPWLADHTIGSAVLVPATAFVELAMAAGDHLGAGRVADLTL
EAPLPLTGRDAVRVQVAVGAPDASGLRPFSVHARPDTGDDGTDRPWTRHVSGALATEAEA
AVPEPDPVFGVWPPEGAAAEPLDGVYDRLAALGYHYGPAFQGLRALWRHGEDLYAEVRLP
EEHREAAAGFGVHPALFDAVLHPLVLDAGADGDSGRIRLPFAWSGVVLHATGATGLRIRI
SPGGPDTYRISMADDTGAPVAGVESLTLRPVDARRLAADADAAPAAALHTVEWAPVPLPA
GAGPDWAEAADGLDAAAGSAIVVVRPPGAPDTAEGAHQPVRDALEVVQRWLADERFAEGR
LAFVTRGAVAALPGDDVTGLAAAPVWGLIRSVQSEHPDRVVLVDLDGDDDRLLPAALAAG
EPQLAVRGGKLYAPRLARRDPAPGRNAPTPALDGTVLVTGGTGGLGALVARHLVTEHGVR
HLLLSSRRGPGTPGADALRSELTALGAEVTVVAADAADRNAVAGLLAAVDARHPLSAVVH
TAGVLDDATAQSLTPEQLATVLRPKVDAARHLHELTKDLDLAAFVLFSSVSGITGTAGQA
NYAAANTYLDALAAHRRASGLPATSLAWGLWDASHGMGGTLGEADLARWARAGMTPLTPK
QGLTLFDTALTGTEPLLVPVALDLARFRTGAEPLPALLRGLVRTRARRAVQAGAGTGGAG
SDWARRIAALPEDKRRDAVLGLVRDTVAAILGHAGGTSVDPERAFNDIGFDSMAGVDLRN
RLGAATGLRLPATVVFDHPTPGAVAAHLLSRVSESSRPADAPTAARRRGPADEPIAIVGM
ACRYPGGVSSPEELWRLVADGVDAVTEFPVNRGWDLENLYDPDPEQTGTSYVREGGFLHD
ADLFDREFFGISPREATATDPQQRLLLETAWETFENAGLDPALLRGSNTGVFTGAMYDDY
ASRLASAPEEFEGFLLAGNLSSVVSGRLSYTYGLEGPAVTVDTACSSSLVALHMAAGALR
SGECDLALAGGVTVMNGPSTFVEFSRQRGLSPDGRCKSFAAGADGTGWSEGVGLLLVERL
SDARRNGHQVLAVVRGSAVNQDGASNGLTAPNGPSQERVIRQALANADLTPADIDAVEAH
GTGTTLGDPIEAQALLATYGQDRAEGRPLYLGSLKSNIGHSQAAAGVGGIIKMIEAMRHG
VLPRTLHVDAPSPHVDWETGTLALLTEETPWPAAGRPRRAGVSSFGISGTNAHVIVEEAP
AAPVDRRPAAGPESSGGVVPWIVSGKDEAALRAQARRLHQYVLDHPDLSPADIGHSLATT
RAVLDQGAAVVGADRESLLRGLAAIERGESAGVVRARSARPGKTAFLFTGQGSQRLGMGR
ELYESSPVFAKALDEVCSRFRAELARPVKDVLFAQEDSATAALIDQTAFTQAALFCVEVA
LYRLFEHHGFTPDYLLGHSIGEVTAAYLSGVLDLDDACCLVAERGRLMQAAREGGAMAAL
QASEEEVYASIAPYGDAVGIAGVNGPESLVISGDEDVVEEVTAAWRANGVRTKRLPVSHA
FHSSHMDEVLDEFREVASGLSFRPPRIPVVSNVTGTLATDAQLTSPDYWATHIREAVRFL
DGVRYLEAQGVTDFLELGPDAVLTALTRGSLEEEAGVLVAALRRDRPEAETVAAAIAALR
LRGAAPAWDTVFPGARRVALPTYAFQHERYWLDAPETSTDAAGLGLSAAGHPLLGAAVRM
AHRDEYLFTGRLSRHSQPWLTEHAVHGTVLVPATGLLELAVRVGGQLGAERVEELMLSAP
LVLPEQGGVQVQLVVGEADGAGRRTVEVFSRLDDGDVTADRPWTLHASGALAPAAGVLGE
PPLPWPPAGAGEVPLDGVYDRLTDVGYAYGPAFQGLRRVWRGDGEIYAEVALPEEQRADA
GRYVLHPALLDAALHPLLPGVADQDRAALLPFTWSGVTIHATGASVLRVRLTLTGPDVAA
LTVTDATGAPVASVESLLLRPLSKDALRQAASTARDGLFRIAWNTLPTTDTPTDTTGWAV
VGDLTVDGATRHTNLDAVRAEDNIPRTVLYAPPVPDGDVPEAAHAALRDALSTTQSWLAD
DRTTDTTLVVVTRGALATREGQHTDPVQAGLWGLLRVAQTENPGRIALLDTDTDTIPTTA
LTTDEPQLALRDNTFHTPRLARTTDQPTDQPTDRPRWDRGTVLITGATGALGTVLARHLV
TQHGTRHLLLLSRRGTNAPGAQELQHELTALGATVTITACDAADRHALTSVLDDIPAEHP
LTAVVHTAGVLDDTVLADLTAERLEKVLRPKVDAAWNLHELTKDHDLEAFVLYSSIAGLI
GNAGQANYAAGNTFLDALAQHRRALGLPAVSLAWGLWAQASTISGQLDQTDLRRLARLGL
LPLSSADAMDLFDAAPATGEAVLAATRLDLGTLRKQGAHLLPLLRDLVPAAPRRAAADTG
GTEGGPSLAERLGALPDEEQRVEALTDLVRVQVAAVLGHSDPGSVDPGRAFQELGFDSLT
AVELRNQLSTVSGLRLPTTLVFDHPSPAALAAHLRQRITVEEGAAATPVLADLDRLKSAI
RSASVDRDAFDRITGRLRELLDVADTANGSAAGDDDTDRDLDTASDEELFALLDDLG
NT seq 13674 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaccagtgagaacaattccgtagcagccggggcgcacaccgggcaggtggagcgg
atcgctgtcgtgggactgtcctgccggctccccggggccgcggaccccgcggcgttctgg
gagctgctgcacagcggttccgacgccgtgaccgaggtgccgccgggccgctgggacgtg
cccgcggacgcggcgcccggctcgggctccgggggccggcgcggggcgttcctggacggt
gtcgaccggttcgacgccggattcttcggcatctcgccgcgtgaggccgccgcgatggac
ccgcagcagcggctcgtgctcgaactgacgtgggaggcgctggaggacgccgcgatcgta
ccggcgtcactgcgcggcagcaggaccgcggtgttcgtgggcaccctgcgcgacgactac
accaacctgctgtaccagtacggggacgaggcggtcacccagcacacgatggccggggtg
aaccggggcgtcatcgcggggcgggtctcgtaccacctggggctgcgcggtccgagtctc
acggtggactcggcgcagtcgtcgtcgctggtcgccgtgcacctggcgtgcgagagcctg
cgcagcggggagtcgacgacggctgtggtggccggtgtgaacctcaatctgctggccgag
aacgccactacggaggaacgtttcggcgcactgtcccccgacggtgtctcgtacaccttc
gacgcccgtgccaacggcttcgtgcccggcgagggcggcggcgtggtggtgctcaagccg
ctgtcggccgccctcgcggacggcaaccggatccatggcgtgatccgcggcacggcggtc
aacaacgacggcgccgccgacgggctcaccgtgcccagcggcaccgcgcaggagcagttg
atccgcgaggcgcaccggcgctccgccctcggcccgggcgagcgggtccagtacgtcgaa
ctgcacggcaccggcaccccggtcggcgacccggtcgaggccgccgcgctcggcgccgcc
ctcggcgcggagcgcggcgacgcggacggcccgctgcgggtcggctcggtcaagaccaac
atcgggcacctggagggcgccgccggcatggcgggcctgatcaagacgctgctcgccatc
acccaccgggaacttcccgccagcctgaacttccggaccgccaacccggcgatcccgctg
gccgaactgggtctggaggttcagcgcgagctctccgcctggccgcgtccggaccgtccg
ctggtggccggcgtcagctcgttcggcatgggcggcaccaacgcgcacgtcgtcgttggc
gagcctcccctcccggccgcggagccggacaccctcaccggctccgcggccccctcctcg
ctctcctgggtggtcaccgccaactccgaggaggcgctgcgcggacaggccgcgcggctc
gccgagttcgccggcgccgagaacgcgcccgacccgcgcgacaccgggtactcgctggcg
acggaccgtacggtcttcgaacaccgcgcggtcgtggtcggcgccgacggcgcggccctg
ctggacggtgtgcgggcgctggccgagggccggccgggcgccggggtcgtccggggccgc
ggcgaggccggtgccaccgccctgctgttcaccgggcagggggcgcagcgaccgggcatg
ggccaggaactctacgccgcgcaccccgtgttcgcggacgccttcgacgccgtggccgag
cggctcgacccgatgctgaagcagcccctgtgggaggtcatcgcctccggagagggcctg
gacgagaccggtcgcacccagccggcgctgttcgcgatcgaggtggcgctcttcaggctg
ctggagtcctggggcgtgcggcccggcttcctcgccggacactcgatcggcgagctggcc
gccgcccacgtcgccggcgtgctgtccctcgacgacgcggcgaggctggtcgcggcccgg
gcccggctgatgcaggcgctgcccgccggcggcgccatgatcgccgtcgaggccaccgag
gaggaggtcctcccccacctggagggactggaggcacgcctgtccctcgcggcggtcaac
gggcccgcctcggtggtgatctcgggcgaggcggacgcggcggaggacgtggcggcacgg
cttgccgaagccgggcgccggaccaagcgcctcaccgtctcgcacgccttccactcgccc
ctcatggacggcatgctcaaggagttccacaaggtcgccaaggaactcacctaccacgcc
ccgcggatacccgtcgtctccaccctcaccggcgctctcgcctcgggcgacgacctgcgt
accccctgctactggacggaccaggtccggcacgccgtgcgcttcgccgacgccgtacgc
accctgggcgagctcggcgcgacggtcctcctggaggtcggcccggacgcggtcctcagc
tcgctcgccgacgccacccccacgctgcgcgccgggcgccccgagacccggacgctgctc
accgcggtcgccaccgcgttcgtccgcggcgccgacgtcgactggcgcgcggtccacgcg
gacgccggcggccgctccgtgccgctgcccacgtacgcgttccagcgccgtaggcactgg
ttcgacgccgcggcccgcaaggagacgcgggcgatcgccccggcggccgacgaggtgcgg
tcaccggccgcggcgtccggcgtcccgtccgtgccggccggccgggccgagcgcctgcgg
tacgccgaggacctggtgacgagccatgtcaccgccgtcctggagtacggggacggcgaa
cggctcgatccgcgcgtcccgttccagaagctcgggttcacctcgctgatgaccacggaa
ctgcgcgccgccctcgccgaggccaccggactggccctgcccggcagcctgctcttcgac
caccccaccccgcgggagctgaccgcgttcctcgccacgcggctggcggacacgacggac
gagccggaggccggggaggagttcatccggcccgccgacgccggcgaaccgatcgcgatc
gtgggcatggcctgccgcttccccggcgggatcacctccccggcgcagttgtggaagctc
gtgtcggagggcggtgacgcgatcaccgagttccccgtgaaccgcggctggcccgacgac
ctctacgacgccgaccccgaccgccccggccgcagcgcggtgcggcacggcggattcctg
cacgacgcgggcgagttcgacgccgacttcttcggcatctcgccgcgcgaggcgctggcc
atggacccgcagcagcggctgctcctggagtcggcgtgggaggccgtggagcgggccggg
atcgacccggacacgctgcgcggctcccgtacgggcgtcttcgtcggcgccaccgcgctg
gagtacggcccgcggatgcacgaggcaccggagtccgtccagggcagtgtcctgaccggc
agcacgacgagcgtcatgtccggccggatcgcctaccagctcgggctgctcggaccggcg
gtcaccaccgacaccgcctgctcttcctcgctggtcgcgctgcacctggcgatccgctcc
ctgcgctcgggcgagaccagcctggcgctggccggcggtgcgaccgtgatgtcgtcgccc
ggcatgttcgtggagttctcgcggcagcggggtctggcgccggacgggcgctgcaagtcc
ttcgccgcgggcgcggacggcaccggctggagcgagggcgtcggcctgctgctcgtcgag
cggctctccgacgcccgccgcaacggccaccaggtactggccgtcgtccgcggttccgcc
gtcaaccaggacggcgcctccaacggcctcaccgcacccaacggcctgtcgcagcagcgc
gtcgtccgccaggccctggccgactccggtctggccgccaccgaggtcgacgcggtcgag
gcgcacggcaccggcacccggctcggcgaccccatcgaggccgaggccctcatggccacc
tacggaaccggccgggacgggctcccaccggtgtacctgggctcgttgaagtccaacatc
ggccacgcccaggcggccgccggtgtcggcggtgtcatcaagatggtcgaggcgatccgg
cacggggtgctgccccggacgctgcacgtcgacgagccgtcaccgcgcgtggactggaac
gcgggcgcgctggagctgctcaccggggaacgggcctggcccgacaccggccggccccgg
cgggccgccgtgtcctccttcggcatcagcggcaccaacgcgcacgtcgtgctcgagcag
gccccggacgcgccgccgccgtccgccgcgccgccggccacccaggctcccgccgtgccc
gcgccctggctgctgtcggcccgtgaccccgacacgttgcgggcccaggccgagcggctg
cgggcgtacgcggacggtgaccgggcgccggaaccggcggcgatcggccgggcgctcgcc
accactcgtaccgccttcgagcagcgcgccgtcgtcctcgccgaggaccgggccggctac
ctggccggtctggacgcgctgatccggggcgccgacgcgcccggcgtcgtcaccggcagc
gcccggagcgcgggccgcaccgcgttcctcttcaccggtcagggcgcccagcgggccggc
atgggccgggagctgtacgcgcgccatccggtgttcgccgaggcactggacgccgcgttc
ggcgcgctcgacgcccatctggacctgccgctgcgcgaggtggtcttcgccgcggagggc
agccgcgaggccgccctgctcgacgagacgacgtacacgcagcccgcgctgttcgccctc
gaagtggcactgttccggctcctggagcaccacggggtcacccccggtctgctggccggg
cactcggtcggtgagctgtccgccgcccacgcggccggggtgctgaccctggacgacgcc
gcgaaactggtcgccgcgcgcggccggctgatgcaggccgcccgctccggcggcgccatg
atcgccgtcgaggccgccgaggaggaggttcttccgtatctggagggcagggcggccggg
ctctccgtcgcggccgtcaacggacccgcgtccgtggtgatctccggcgacgaggagccg
gccctcgaggtcgcggaactgctgcgggcgtcgggccgcaggaccaagcggctcacggtc
tcgcacgccttccactccccgcacatggacggcgtcctcgacgcgttccgcgaggtcgcg
tccacggtcgccttctcggcgcccaccgtgccgatcgtctccaccgtgacgggccggctc
gccaccgaggccgaactcacctcaccccagtactgggcgaaccagatccgcgcggccgtc
cgcttcctcgacgcggcccgcgaactcgccgcccagggcgccaccgtgttcgtcgaggcc
ggaccggacgccgtgctgaccgcgctcacccgggccgcgctggaggacaccggagccacg
gccgtgccgctgatgcgcgcgggccgaccggaggccgagacgctgaccctgggcctcggg
ggcgcccacgccgcgggggccgccctggacgcggcgacgttcttccccggcgcggccacc
gccgacggcctgccgacgtacgccttccggcgcacccattactggctggcgcccgcgtcg
cccaccgacgcccgcagcctcggcctggacgcctcggagcacccgctgctgtccacctcc
gtggaactcgccggccgggaggacacgctgttcaccggtcggctgtcgctgagcggccat
ccgtggctggcggaccacaccatcggctcggccgtgctggtacccgccaccgccttcgtc
gaactcgccatggcggccggggaccacctcggcgccggccgggtcgcggacctcacgctg
gaggcaccgctgccgctgaccggccgggacgccgtgcgggtccaggtcgccgtcggcgcc
ccggacgcctcggggctgcggccgttctccgtccacgcccgtcccgacaccggcgacgac
ggcaccgaccgcccctggacccggcacgtgagcggtgccctcgccaccgaggccgaggcc
gccgtccccgagcccgaccccgtcttcggcgtctggccaccggagggcgccgcggccgag
ccgctggacggcgtgtacgaccggctggccgcgctcggctaccactacggaccggccttc
caggggctgcgggccctgtggcggcacggcgaggacctgtacgcggaggtgcggctgccg
gaggaacaccgggaggccgccgcgggcttcggtgtgcaccccgcactgttcgacgccgtc
ctgcaccccctggtgctggacgcgggagccgacggcgactccggccggatccggctgccc
ttcgcctggtccggggtcgtcctgcacgccaccggcgccaccggcctgcggatccggatc
tcccccggcggccccgacacctaccgcatctccatggccgacgacacgggcgcgccggtc
gccggcgtcgagtcgctgaccctgcgcccggtcgacgcccgccggctcgcggccgacgcc
gacgccgccccggccgccgcgctccacacggtggagtgggcccccgtccccctcccggcc
ggcgccggtccggactgggccgaggcggccgacggcctcgacgccgccgcgggctccgcc
atcgtggtcgtacggccgcccggcgcgccagacaccgccgagggcgcgcaccagcccgtg
cgcgacgcgctggaagtggtccagcggtggctggccgacgaacggttcgccgaggggcgg
ctggcgttcgtcacccgcggcgccgtcgcggcacttcccggcgacgacgtcaccggcctc
gccgcggcgccggtgtggggcctgatccgctcggtgcagtccgagcaccccgaccgtgtc
gtgctggtggacctcgacggtgacgacgaccgtctgctgcccgccgcgctcgcggccggg
gaaccccagctcgccgtccgcggcggcaagctgtacgccccacggctggcccgccgcgac
cccgcgcccggacggaacgcaccgaccccggccctggacggcaccgtcctcgtcaccggc
ggcaccggcgggctcggcgcgctcgtcgcccggcacctcgtcaccgagcacggcgtgcgc
cacctgctgctcagcagccgccgcggccccggcacgccgggcgccgacgcgctgcggtcg
gaactgaccgcgctgggcgccgaggtgaccgtggtcgccgccgacgccgccgaccggaac
gccgtcgccgggctgctcgccgccgtcgacgcccggcacccgctgtcggcggtggtgcac
accgcgggcgtcctcgacgacgcgaccgcgcagtcgctcacaccggagcaactcgccacg
gtgctgcgccccaaggtcgacgcggcccggcatctgcacgagctgacgaaggacctcgac
ctggcggccttcgtactgttctcctcggtctccggcatcaccggcaccgcgggccaggcc
aactacgccgcggccaacacctatctggacgccctggccgcgcaccgccgcgcctccggg
ctgcccgcgacctcgctcgcctgggggctgtgggacgcctcgcacggcatgggcggcacc
ctcggcgaggccgacctcgcccgctgggcccgcgccggaatgaccccgctcaccccgaag
cagggcctgaccctgttcgacaccgcgctgacgggcaccgagccgctgctggtaccggtg
gcgctggacctggcccgcttccgtaccggcgccgagccgctgcccgcgctcctgcgcgga
ctggtgcgcacccgtgcccgccgcgccgtgcaggccggtgcgggcaccgggggtgccgga
tcggactgggcgcgccggatcgcggcactgcccgaggacaagcgccgcgacgcggtcctg
ggcctggtccgggacaccgtcgccgcgatcctcggccacgcgggcggcacctccgtcgac
cccgaacgcgctttcaacgacatcggcttcgactcgatggccggtgttgacctgcgcaac
cgcctcggtgccgccacgggtctgcggctgcccgcgacggtggtcttcgaccatccgacg
ccgggggccgtggcggcccatctgctctcccgggtctccgagagctcgcggccggccgac
gcaccgacggcggcccggcggcgcggcccggccgacgagccgatcgcgatcgtcggcatg
gcctgccgctacccgggcggggtgtcctcgccggaggagctgtggcggctggtggcggac
ggtgtggacgccgtcaccgagttccccgtcaaccggggctgggacctggagaacctgtac
gacccggacccggagcagaccggtacctcgtacgtccgcgagggcggcttcctgcacgat
gccgacctgttcgaccgggagttcttcggcatctcgccgcgcgaggcgacggccaccgat
ccgcagcagcggctgctgctggagaccgcttgggagaccttcgagaacgccggcctcgac
cccgccctgctgcggggctccaacaccggtgtcttcaccggcgcgatgtacgacgactac
gcgtcgcggctggcgtccgctccggaggagttcgagggtttcctgctcgccgggaacctg
tccagcgtcgtctcgggccggctgtcgtacacgtacggcctggagggtccggcggtcacc
gtggacacggcgtgctcctcgtcgctggtggcgctgcacatggcggcgggtgcgctgcgt
tccggtgagtgcgacctcgccctggcgggcggggtgacggtgatgaacggtcccagcacg
ttcgtggagttctcacggcagcggggtctgtcgccggacggccgctgcaagtccttcgcc
gcgggcgcggacggcaccggctggagcgagggcgtcggcctgctgctcgtcgagcggctc
tccgacgcccgccgcaacggccaccaggtgctggccgtcgtccgcggctccgccgtcaac
caggacggcgcctccaacggcctcaccgcccccaacggcccctcccaggaacgggtcatc
cgccaggccctggccaacgcggacctgacccccgccgacatcgacgccgtcgaggcacac
ggcaccggcaccaccctcggcgaccccatcgaggcccaggcactgctggcgacgtacggc
caggaccgggcggagggccggcccctgtacctcggctcactcaagtccaacatcggacac
agccaggccgccgccggagtcggcgggatcatcaagatgatcgaggcgatgcgccacggg
gtgctgcccaggaccctgcacgtcgacgcgccgtccccgcacgtcgactgggagacgggc
accctggcgctgctcacggaggagaccccctggccggccgccggccgcccccgccgggcg
ggcgtgtcctccttcggcatcagcggcaccaacgcccacgtgatcgtggaggaggcgccc
gcggcaccggtggaccgccgcccagccgccggcccggagtcctcgggcggcgtggtgccg
tggatcgtgtccgggaaggacgaggccgcgctgcgggcccaggcacggaggctgcaccag
tacgtgctggaccacccggacctgtcacccgccgacatcggccactccctcgcgaccacc
cgcgcggtcctggaccagggtgcggccgtcgtcggcgccgaccgcgagtcgctgctgcgg
gggctcgcggcgatcgagcgcggtgagtcggccggggtcgtccgggcccgttcggcacgg
ccggggaagaccgcgttcctgttcaccgggcagggcagccagcggctcggcatgggacgc
gaactctacgagagcagtcccgtgttcgcgaaggcgctggacgaggtgtgctcccgtttc
cgggccgaactcgcccgtcccgtcaaggacgtgctgttcgcccaggaggactccgcgacc
gccgccctgatcgaccagaccgcgttcacgcaggccgcgctgttctgcgtcgaggtcgcg
ctgtaccggctcttcgagcatcacggattcactcccgactatcttctcggccactccatc
ggcgaggtcaccgccgcgtatctctccggggtgctcgacctggacgacgcctgctgtctg
gtcgccgagcgcggccggctgatgcaggccgcccgcgagggaggcgcgatggccgccttg
caggcctccgaggaggaggtgtacgcctcgatcgcgccgtacggcgacgcggtgggcatc
gccggggtcaacggccccgagtcgttggtgatctccggggacgaggacgtcgtggaggag
gtcaccgcggcctggcgggccaacggggtccgcacgaagcggctgccggtgtcgcacgcc
ttccactcctcgcacatggacgaggtcctcgacgagttccgcgaggtcgcctccgggctg
tccttccggccgccgcgcatcccggtcgtctccaacgtgaccggcaccctcgccaccgac
gcgcagctgacctcgccggactactgggccacccacatccgggaggcggtgcgcttcctg
gacggagtgcgctacctggaggcccagggcgtcaccgacttcctggaactcggcccggac
gcggtgctcacggcgctcacccggggcagtctggaagaggaagccggtgtcctggtcgcg
gcgctgcgccgggaccggcccgaggccgagaccgtcgccgcggcgatcgccgcactgcgg
ctgcgcggcgcggcccccgcctgggacacggtcttccccggcgcccgccgggtcgccctg
ccgacgtacgccttccagcacgagcggtactggctggacgcacccgagacatccaccgac
gcggccgggctcggcctgtccgccgccggtcacccccttctcggggccgccgtgcgcatg
gcgcaccgcgacgagtacctgttcaccggccgcctgtcgcgccactcccagccctggctg
accgagcacgcggtgcacggcacggtgctggtgccggcgacggggctgctggagctggcg
gtgcgggtcggcgggcagttgggcgcggagcgggtcgaggagctgatgctgtcggcgccg
ctggtcctgcccgagcagggcggtgtccaggtgcagctggtggtcggcgaggccgacggt
gccgggcggcgcacggtcgaggtcttctcacggctcgacgacggcgacgtcaccgcggac
cgtccgtggacgctgcacgcgagcggtgccctggccccggccgccggcgtcctcggtgag
ccgccgctgccgtggccgcccgccggcgccggcgaggtgccgctcgacggggtctatgac
cggctgaccgatgtgggatatgcgtacggtccggctttccagggtctgcggcgggtatgg
cgcggcgacggcgagatctacgccgaggttgccctgcccgaggagcagcgcgccgacgcg
ggacgctacgtcctgcacccggccctgctcgacgccgcactgcaccccctgctgcccggc
gtcgccgaccaggaccgcgcggcactgctgcccttcacctggtccggcgtcaccatccac
gccacaggcgcctccgtactacgcgtgcggctgacactcaccgggcccgacgtcgcggcc
ttgacggtgacggacgcaaccggcgccccggtcgcctccgtcgaatccctcctgctgcgc
cccctgtccaaggacgcactgcgccaagccgcctccaccgcccgcgacggactcttccgc
atcgcctggaacacactgcccaccaccgacacccccaccgacaccaccggctgggccgtc
gtcggcgacctgacggtcgacggagcgacccgacacacaaacctggacgccgtgagggcc
gaagacaacatcccccgaacggttctgtacgccccgcccgtcccagacggtgacgtgccg
gaagcggcccacgccgcactgcgcgacgccctcagcaccacgcagtcctggctggccgac
gaccgcaccaccgacaccaccctcgtcgtcgtcacccggggcgccctcgccacccgcgaa
ggacagcacaccgatcccgtacaggccggcctctggggcctgctccgcgtcgcccagacc
gagaaccccggccgcatcgccctcctcgacaccgacaccgacaccatccccaccaccgcc
ctgaccaccgacgaaccccaactcgccctccgcgacaacactttccacacccctcgcctg
gcccgcaccaccgaccagcccaccgaccagcccaccgaccggccccgctgggaccgcggc
accgtcctcatcaccggcgccaccggcgccctcggcaccgtcctcgcccgccacctcgtc
acccagcacggcacccgccaccttctcctcctcagccgacgcggcaccaacgcccccggc
gcacaagaactccagcatgaactcaccgccctcggcgccaccgtcaccatcaccgcctgc
gacgccgccgaccgccacgccctcacctccgtactcgacgacatccccgccgaacacccc
ctcaccgccgtcgtccacaccgccggcgtcctcgacgacaccgtcctggcggatctgacg
gccgagcggctggagaaggtactgcgtccgaaggtcgacgcggcgtggaacctgcacgaa
ctgaccaaggaccacgacctggaggcattcgtcctctactcctccatcgccggcctcatc
ggcaacgccggccaggccaactacgccgccggaaacaccttcctggacgccctcgcccag
caccgcagggcactcggactgcccgccgtctccctcgcctggggcctgtgggcccaggcc
agcaccatcagcggacaactcgaccagaccgacctgcgccggctcgcccggctgggcctg
ctgccgctgtcgtccgccgacgcgatggacctgttcgacgcggccccggccaccggcgaa
gcggtcctcgcggccacccggctggacctcggaacactgcgcaagcagggcgcgcatctg
ctcccgctgctgcgggacctcgtgccggccgcgccgcgccgtgcggcggcggacaccggc
ggtaccgagggcggaccctcgctggcggagcggctcggtgccctgccggacgaagagcag
cgcgtcgaggctctgacggacctcgtgcgcgtccaggtggccgcggtgctcggccactcc
gatcccggctccgtcgaccccggccgggccttccaggagctgggcttcgactcactgaca
gccgtcgaactccgcaaccagctgagcaccgtgagcggactgcgcctgcccaccaccctc
gtcttcgaccacccctcccccgccgccctcgccgcccatctgcggcagcggatcacggtc
gaggagggggcggccgccactccggtcctcgcggatctggaccgtctgaagtcggccatc
cggtccgcttcggtggaccgggacgcgttcgaccggatcaccggtcggctgcgcgagttg
ctggacgtcgccgacacggcgaacggcagcgcggccggggacgacgacaccgaccgggac
ctggacacagccagcgacgaggagctgttcgccctcctcgacgacctcggctga

DBGET integrated database retrieval system