KEGG   Streptomyces coelicolor: SCO6498Help
Entry
SCO6498           CDS       T00085                                 

Gene name
SC1E6.07
Definition
(RefSeq) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sco00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SCO6498 (SC1E6.07)
Enzymes [BR:sco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCO6498 (SC1E6.07)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SCO6498 (SC1E6.07)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-GeneID: 1101937
NCBI-ProteinID: NP_630580
Kitasato: SCO6498
UniProt: Q9ZC15
LinkDB All DBs
Position
7192805..7193764
Genome map
AA seq 319 aa AA seqDB search
MTGSGGTGGGGRGGGARTVRAGRHTVEVHRPDKVLFPVGEGGTEEYTKGDLVDYHRAAAP
FMLPHLRGRPLMLERHPDGVDGPRFMQKNTPEHYPEWIDRVEVGKEGGTVCHTVCDDSAT
LVYLADQAALTLHRWLSRTGRLDRPDRMVFDLDPAQDDFEAVRAAARLLAGLLDELKLPS
APMTTGSRGLHVVVPLDGRQDFDDVREFARAVADVLAAAHPDRLTTAARKKDRGDRLYLD
IQRNAYAQTAVAPLTVRARPGAPVATPISWDQLDDPALHARRWTVADAVEQARTRPWAGI
MNSPRALGPARRRLNALHG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggagcggcggcacggggggcggcggcaggggtggcggcgcccggaccgtgcgg
gccggacggcacacggtggaggtccaccggccggacaaggtgctgttcccggtcggtgag
ggcggtacggaggagtacaccaagggcgatctcgtcgactaccaccgtgccgcggccccg
ttcatgctgccgcatctgcggggccgcccgctgatgctggaacggcatccggacggcgtc
gacggtccgcggttcatgcagaagaacaccccggagcactacccggagtggatcgaccgc
gtcgaggtcggcaaggagggcggcaccgtctgccacaccgtgtgcgacgactccgccacc
ctcgtgtacctcgccgaccaggccgcgctcaccctgcaccgctggctgtcccggaccggg
cggctcgaccggcccgaccgcatggtcttcgacctcgacccggcccaggacgatttcgag
gcggtgcgcgcggcggcccggctgctggccggactgctcgacgagctgaagctgccctcc
gcgccgatgaccaccggttcccgggggctgcacgtggtcgtgccgctggacggccgccag
gacttcgacgacgtacgggagttcgcgcgggccgtcgccgacgtcctggccgccgcccac
cccgaccggctcaccacggccgcccgcaagaaggaccgcggggaccggctctacctcgac
atccagcgcaacgcctacgcgcagaccgccgtcgcgcccctcaccgtccgcgcccgcccc
ggcgcccccgtggccacgcccatctcctgggaccagctggacgacccggccctgcacgcc
cgccgctggaccgtcgccgacgccgtggagcaggcccgcacccggccctgggcagggatc
atgaacagcccccgtgccctgggccccgcccggcggcgcctgaacgccttgcacggctga

DBGET integrated database retrieval system