KEGG   Streptomyces coelicolor: SCO6557Help
Entry
SCO6557           CDS       T00085                                 

Gene name
SC4B5.07c
Definition
(RefSeq) neuramidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sco  Streptomyces coelicolor
Pathway
sco00511  Other glycan degradation
sco00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SCO6557 (SC4B5.07c)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SCO6557 (SC4B5.07c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sco02042]
    SCO6557 (SC4B5.07c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SCO6557 (SC4B5.07c)
Bacterial toxins [BR:sco02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SCO6557 (SC4B5.07c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR Laminin_G_2 BNR_3 DUF4185 Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 1101996
NCBI-ProteinID: NP_630638
Kitasato: SCO6557
UniProt: Q9ZBW1
LinkDB All DBs
Position
complement(7255596..7257542)
Genome map
AA seq 648 aa AA seqDB search
MPPRTRRPFWLALATSCALAVSSPFPAHARPGDRAPAFGEQVLFDAARDPGGYACFRIPA
IVRTTDGTLLAFAEGRVLDCADDGDIDIVLRRSLDGGRTWGPLRVVNDGGGDTHGNPAPV
VDRATGRVLLLETYNAGRTDSADCAVPCARVPHVQHSDDGGRTWSAPRDLSPEILPPDWN
SWYATGPVHGVQLTGGAHPGRLVVGVNAETWDGERSEMGVPPAGGWGRVTANHAALVVSD
DGGEHWRTGATDTWPVAADGTFRQKPSELTLTERADGALLVSGREENGTDPGHRTQALSR
DGGDSFAAPFRALPDLYAPQVQGAVLRLGNRILLSAPADPDRRRTMTVRSSRDGGATWDS
ADRGTVVTRDWAGYSDLVTVDDDTVGLLYEGGKTDARDEIRFARLTADRLAPPRGPDPTT
PDLAANAAPAAVLGGAAPTTDGAVGGALAFDGADDAVRLPYDGRLALGEGDFTASLWFRY
SAADGEQPLLWMGGIGTTQPQVWLRAEPDAGRVQGLITARDGATAPRSAWVRTDRAYDDG
RWHRLTLRRGGGRLTLFVDGSAAADAADVPGSVSRNSPFGVHIGERMDGRARFTGAVDDV
QVWNSALTDTEIAAGVPPAAGRSTVLHLPLDRVDEAAADTGGSTDTGG
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgccccctcgaacccgccgtcccttctggctcgcgctcgccacgtcctgcgcgctggcc
gtgtcctctcccttcccggcacacgcgcgacccggcgaccgcgcgcccgcgttcggggag
caggtgctcttcgacgcggcccgcgaccccggcggatacgcctgcttccgcatcccggcg
atcgtgcgcacgacggacggcacgctgctcgccttcgccgagggccgcgtcctcgactgc
gcggacgacggtgacatcgacatcgtcctcagacgctcgttggacggtgggcgtacctgg
ggcccgctgcgggtcgtcaacgacggcggcggcgacacccacggcaacccggccccggtc
gtcgaccgcgcgaccggccgcgtcctgctgctggagacgtacaacgcgggccgcacggac
tccgccgactgcgcggtcccctgcgcccgcgtgccccacgtccagcacagcgacgacggc
ggccgcacctggtccgcgccccgcgacctgagccccgagatcctgccgcccgactggaac
tcctggtacgccaccggccccgtgcacggcgtgcagctcaccggcggcgcccacccgggg
cggctcgtcgtcggcgtcaacgccgagacctgggacggcgagcgaagcgagatgggggtc
cccccggccggaggctgggggagggtcaccgccaaccacgcggccctcgtcgtcagcgac
gacggcggcgagcactggaggaccggcgccaccgacacctggcccgtcgccgccgacggc
accttccggcagaagccctccgagctgaccctcaccgaacgcgccgacggcgccctcctg
gtcagcggccgggaggagaacggcaccgacccgggccaccgcacccaggcactcagccgg
gacggcggcgacagtttcgcggcgcccttccgggccctgcccgacctgtacgccccgcag
gtgcagggtgcggtgctgcgtctcggcaaccgcatcctgctgtcggcgcccgccgacccc
gaccgccgccggacgatgacggtccgctcctcccgggacggcggcgcgacctgggacagc
gcggaccgcggcacggtcgtcacccgggactgggccggctactcggacctggtgacggtc
gacgacgacaccgtgggcctgctgtacgagggcgggaagaccgacgcccgcgacgagatc
cgcttcgcccgcctcaccgcggaccggctcgctccgccccggggccccgaccccaccacc
cccgacctcgccgccaacgccgcccccgcggccgtgctcggcggcgccgcgccgaccacg
gacggcgcggtgggcggcgcgctcgcgttcgacggcgcggacgacgccgtacggctgccc
tacgacgggcggctggcgctcggggagggggacttcacggcgtcgctgtggttccggtac
tcggcggccgacggggagcagccgctgctgtggatgggcggcatcggcaccacccagccc
caggtgtggctgcgcgccgaaccggacgccgggcgggtgcaggggctgatcaccgcccgc
gacggcgcgacggccccgcgctcggcatgggtgcgcacggaccgcgcgtacgacgacggg
cgatggcaccgtctgacgctgcgccgcggcggggggcggctcacgctgttcgtcgacggt
tcggcggcggccgacgcggcggacgtgccgggctcggtcagccggaactcacccttcggg
gtgcacatcggcgaacggatggacggccgggcccgcttcaccggcgccgtcgacgacgta
caggtatggaacagcgccctgacggacacggagatcgccgccggtgtcccgcccgccgcc
ggccggagcaccgtcctgcacctccccctggaccgggtggacgaggcggccgcggacacg
ggcggcagcacggacacgggcggctga

DBGET integrated database retrieval system