KEGG   Streptomyces coelicolor: SCO6707Help
Entry
SCO6707           CDS       T00085                                 

Gene name
ligC
Definition
(RefSeq) ATP-dependent DNA ligase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 1102146
NCBI-ProteinID: NP_630780
Kitasato: SCO6707
UniProt: Q9XAM3
LinkDB All DBs
Position
complement(7458874..7459941)
Genome map
AA seq 355 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMHYEAKWDGFRAIVYRDGDEVELGSRTGKPLTRYFPE
LVVAVRERLPERCVVDGEIVIARDGHLDFDALTERIHPADSRVRTLAERTPASLVAFDLL
ALDDASLLDVGLADRRALLVRALSGVTPPVHVAPATDDIEVARRWFEQYEGAGLDGVVAK
PLDLRYRQDERAMYKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDDRGLLQHVGVSAA
FTMKRRAELVAELEPLRMDDARGHPWAAWAEEAAHESARLPGAPSRWSGKKDLSWVPLRP
ERVVEVAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEILGGP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggacctccccgtcatgccgcccgtgaagccgatgctcgccaagtccgtggcgaagatc
ccgccggggatgcactacgaggccaagtgggacggtttccgtgcgatcgtgtaccgcgac
ggggacgaggtggagctggggagccgtacgggcaagccgctgaccaggtatttcccggag
ctggtggtggcggtgcgggagcggctgcccgagcggtgcgtggtggacggggagatcgtc
atcgcgcgggacggtcacctggacttcgacgcgctcaccgagcggatccatccggccgac
tcccgggtgcggaccctcgcggagcgcacgccggcctcgctggtggccttcgacctgctg
gcgctggacgacgcgtccctgctcgacgtggggctggccgaccggcgggcgctgctggtg
cgggcgctgtcgggggtgacgccgccggtgcacgtggcgccggcgacggacgacatcgag
gtggcccggcggtggttcgagcagtacgagggggcggggctcgacggcgtcgtcgccaag
ccgctcgatctgcgctaccggcaggacgagcgggccatgtacaagatcaagcacgagcgg
acggcggacgtcgtcgtcgccgggtaccgcttccacaagagcgggcccgtggtcggctcg
ctgctgctcggtctgtacgacgaccgggggctgctccagcacgtgggggtgagtgccgcc
ttcacgatgaagcgccgggccgagctggtggcggagctggaaccgctgcgcatggacgac
gcccgggggcatccgtgggccgcctgggccgaggaggcggcgcacgagtcggcgcggctg
cccggcgcgccgagccgctggtcgggcaagaaggacctgtcctgggtgccgctgcgtccc
gagcgggtggtcgaggtggcgtacgaccacatggagaacggggcgcgcttcaggcacacg
gcccgcttccgccgctggcgcccggaccggacccccgagagctgcacctacgcgcagctg
gaggagccggtccgctacgacctggcggagatcctcggcgggccctga

DBGET integrated database retrieval system