KEGG   Streptomyces coelicolor: SCO7345Help
Entry
SCO7345           CDS       T00085                                 

Gene name
SC4G10.24c
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SCO7345 (SC4G10.24c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sco03400]
    SCO7345 (SC4G10.24c)
Enzymes [BR:sco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCO7345 (SC4G10.24c)
DNA repair and recombination proteins [BR:sco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SCO7345 (SC4G10.24c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-GeneID: 1102783
NCBI-ProteinID: NP_631399
Kitasato: SCO7345
UniProt: Q9KXZ8
LinkDB All DBs
Position
complement(8158531..8159511)
Genome map
AA seq 326 aa AA seqDB search
MELPPIPPMLATPGTLPPAGQDTRWAYETKQDGQRVVVYLPGDGSVLLRARSGQDITAAY
PELAPLATALGGTPAVLDGEVLALDEQGRADFQLLQSRMGLAHTPARAAHRAAKVPVHLV
LFDALHLAGRSLLRLPYTGRRERLTDLGLNGPSWSTPAALVGHGAQALRATREHGLEGLV
CKRLDSVYEPGVRSRAWIKIRNMRSEDVVVGGWLPGKGRLGGLPGAVLVGQRAAGRLRYV
GGVGTGWSAGERTELAALLAAAASDVCPFDPVPRVPGARWVVPRLVGEVRYSTRTREGML
RQPSWLRLRPDLAPEESAADLPDDLA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggagctgccgccgatccctccgatgctcgccacccccggcaccctgccgcccgccggg
caggacacgcgctgggcctacgagaccaagcaggacggacagcgcgtggtggtctacctg
cccggcgacggaagcgtcctgctgcgtgcccgctccggccaggacatcaccgccgcctat
ccggaactggctccgctcgccaccgcgctcggcgggacccccgccgtactggacggggag
gtgctggccctggacgaacagggccgtgccgacttccagttgctccagtcccggatgggc
ctcgcgcacacaccggcccgggcggcgcaccgggcggcgaaggtccccgtccacctggtg
ctcttcgacgccctgcacctggcgggccgctccctgctgcgcctgccctacaccggccgc
cgtgagcggctgacggacctcgggctgaacgggccgtcgtggtcgaccccggccgcgctg
gtcgggcacggcgcacaggccctgcgggccacccgcgagcacggcctggaggggctggtg
tgcaagcggctggactcggtgtacgagcccggggtccgctcccgggcctggatcaagatc
cgcaacatgcgcagcgaggacgtcgtggtgggcggctggctgcccggcaaggggcggctc
ggcggtctcccgggcgccgtcctggtcggccagcgcgccgctggccggctgcgctacgtc
ggcggggtcggcaccggctggagcgcgggcgagcgcaccgagctggccgcgctgctggcg
gccgctgccagtgacgtctgccccttcgacccggtgccgcgggtgccgggggcgcgctgg
gtcgtgccccggctggtcggcgaggtccgctacagcacccgcacccgggagggcatgctg
cgccagccgtcctggctcaggctccgtccggacctggcacccgaggagtcggccgcggac
ctgccggacgacctggcgtga

DBGET integrated database retrieval system