KEGG   Staphylococcus cohnii: BZ166_00700Help
Entry
BZ166_00700       CDS       T05008                                 

Definition
(GenBank) competence protein ComK
  KO
K02250  competence protein ComK
Organism
scoh  Staphylococcus cohnii
Pathway
scoh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:scoh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BZ166_00700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:scoh03000]
    BZ166_00700
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:scoh02044]
    BZ166_00700
Transcription factors [BR:scoh03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BZ166_00700
Secretion system [BR:scoh02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BZ166_00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK Binary_toxB_3 Peptidase_C1
Motif
Other DBs
NCBI-ProteinID: AQM40381
UniProt: A0A3A0JEN9
LinkDB All DBs
Position
complement(147861..148424)
Genome map
AA seq 187 aa AA seqDB search
MIQPYIIKKGDMSLQPCHLPVGQYEGTRVLRYKEDESTIKERTHKIIDRSCRFYGSSYVF
KKEDTIRITGISSKPPILFTPLFPTYFFPTHSDRKTQNTWINIHYVQSIKSLKDKKCKVN
FVDNQSIVVNISAHSMQHQYLNGIYYYYMMDRAARVATFDPESPIDYTKPQLNIYEALAK
YSLFESK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaccgtatattattaaaaaaggtgatatgtcattgcaaccgtgccatttaccc
gttggccaatatgaaggaacaagagtgctaaggtataaagaagatgaaagtacaataaaa
gaacgtacccacaaaattattgaccgctcttgtagattttatggtagtagttatgttttt
aaaaaagaggataccattcgaattacaggtattagcagcaagcccccgattttattcact
cctttatttcccacttatttttttccaacacattctgatagaaaaacacaaaatacatgg
attaatatccattatgttcaaagtattaaatcactaaaagataaaaaatgcaaagtgaac
tttgttgataatcaatctatcgttgtaaacatttcagctcatagcatgcaacatcaatat
ttaaatggtatttattattattatatgatggatagagcggcaagagttgcaacttttgat
ccagaatctcctatagattatacaaaaccacaattaaatatatatgaagcacttgctaag
tattctttgtttgaaagtaaatag

DBGET integrated database retrieval system