KEGG   Staphylococcus cohnii: BZ166_03790Help
Entry
BZ166_03790       CDS       T05008                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
scoh  Staphylococcus cohnii
Brite
KEGG Orthology (KO) [BR:scoh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BZ166_03790
Enzymes [BR:scoh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BZ166_03790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like Thioredoxin_3 GIDA DAO Thi4 FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 NAD_binding_9 K_oxygenase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AQM40825
LinkDB All DBs
Position
775902..777425
Genome map
AA seq 507 aa AA seqDB search
MLNDQLKSQLQQLLQLMEGDVVLRASLGSDDKSKELKELLDEVVAASSHITIEEKDLKRT
PSFTVDKPDADTGITFAGLPMGHEFNSLVLALLQVSGRAPKEEQSVIDQIKALDRPLNFE
TYISLTCQKCPDVVQALNLMSLLNPNITHTMIDGAIFREESEDIMAVPAIYLDGEEFGNG
RMTVQDILSELGSKADPSEFNDKDPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTATIENFITVKETDGPKFSSALEDHVKQYNVDTMTGVRASDIEKTDNGIIVTLDND
AKLQSKTVIIATGARWRKLEVPGEEALINKGVAFCPHCDGPLFENKNVAVVGGGNSGVEA
AIDLAGIVEHVTLLERNASLKADDVLQERLSSLPNVTIIKNAQTTEVLGEASVTGLKYQD
KSTGEDHTIELEGIFVQIGLLPNTEWLDNYVELNQANEIIIDRTNATSIPGIFAAGDVTD
DRNKQIIISMGAGANAALNAFDYIIRH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgatcagctaaaatcacaattacaacaattacttcaattaatggaaggtgat
gttgtactacgcgcaagtcttggttcagatgataaatcgaaagaactaaaagagttgcta
gacgaagttgtagcagcatcatctcatatcacaattgaagagaaagacctaaaacgtaca
ccaagctttacagtagataaacctgacgcagacacagggattacatttgctggtttacct
atgggtcacgaatttaattcacttgtattagctttattacaagtcagtggtcgcgcacct
aaagaagagcaatctgtcatagatcaaattaaagctttagatcgcccactcaattttgaa
acttatatcagtttaacgtgtcaaaaatgcccggatgtcgttcaagcattgaacttaatg
agtttattaaatccaaatatcactcatacaatgattgacggtgctattttcagagaggaa
tctgaagatattatggcagtgccagctatctatttagatggtgaagaatttggcaatgga
cgcatgactgtacaagatatattatctgaactaggtagtaaagcagacccttcggaattc
aatgataaagatccttacgacgtgttaatcgttggtggtggacccgcaagtggtagtgcc
gctatctatactgcacgtaaaggattacgcactggtattgttgcagatcgcattggtggt
caagtcaacgatactgcaacaattgaaaactttattacagttaaagaaacggatggtcct
aagttctcctctgcacttgaagatcatgtaaagcaatataatgtagataccatgacaggt
gtcagagcaagtgatattgaaaaaacagacaatggtattattgtcactttagataatgac
gctaaattacaaagtaaaaccgtgattattgctacaggtgcacgttggcgtaagctagaa
gtacctggtgaagaagcccttattaataaaggggtggcattctgcccgcactgtgacgga
cctctatttgaaaataaaaacgttgctgttgttggtggcggtaactcaggtgtagaagct
gcaatagacttagcaggtattgtagaacatgttacactacttgagcgtaacgcttccctt
aaagcagacgacgtattacaagaacgtttaagctctttaccaaacgttacaattatcaag
aacgcacaaacaactgaagttttaggtgaagcttcagtgacgggtcttaaatatcaagac
aaatcaactggtgaagaccacactatagaattggaaggtatattcgtacaaatcggatta
cttccaaatacagaatggttagataactatgttgagttaaaccaagcaaatgaaataatc
attgatcgtacaaacgctacaagcatcccaggtatatttgctgcaggcgatgttacagac
gatcgtaataaacaaatcattatttcaatgggcgctggtgcaaatgctgcattaaatgca
tttgattatatcattcgacactaa

DBGET integrated database retrieval system