KEGG   Staphylococcus cohnii: BZ166_06925Help
Entry
BZ166_06925       CDS       T05008                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scoh  Staphylococcus cohnii
Pathway
scoh00010  Glycolysis / Gluconeogenesis
scoh00260  Glycine, serine and threonine metabolism
scoh00680  Methane metabolism
scoh01100  Metabolic pathways
scoh01110  Biosynthesis of secondary metabolites
scoh01120  Microbial metabolism in diverse environments
scoh01130  Biosynthesis of antibiotics
scoh01200  Carbon metabolism
scoh01230  Biosynthesis of amino acids
Module
scoh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scoh_M00002  Glycolysis, core module involving three-carbon compounds
scoh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:scoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZ166_06925
  09102 Energy metabolism
   00680 Methane metabolism
    BZ166_06925
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BZ166_06925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:scoh04131]
    BZ166_06925
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scoh04147]
    BZ166_06925
Enzymes [BR:scoh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BZ166_06925
Membrane trafficking [BR:scoh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BZ166_06925
Exosome [BR:scoh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BZ166_06925
  Exosomal proteins of melanoma cells
   BZ166_06925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AQM41279
LinkDB All DBs
Position
1485005..1485691
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSVWNAENLFTGWADVDLSEQGRTEAVTSGKKLKEQGIEIDIAFTSLLQR
AIKTTFHLLDESQQLFIPVIKSWRLNERHYGGLQGLNKDKAREKFGEEQVHIWRRSYDIA
PPEQSEEQRKDYLNDRKYEHLDRRVMPESESLKDTLIRVIPYWNDQISQQLLDGKTVLVS
AHGNSLRALIKYLEDVSDEDIVGYEIKTGAPLIYDLTDDLKVINKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaactaattttatgtagacatggacaaagtgtttggaatgctgagaatctattt
acaggttgggctgatgtagatttatcagaacagggaagaactgaggcagtaacgtcggga
aaaaaattaaaagaacagggtatagagattgatatcgcctttacgtctttattacaacgc
gccattaaaactacatttcacttattagatgaatctcaacagttatttattcctgttatt
aaatcttggcgcttaaatgagcgtcattatggtggattgcaaggtttaaacaaagataaa
gcaagagaaaaatttggagaagaacaagtacatatatggagacgttcatatgacatagca
ccacctgaacaaagtgaagaacaaagaaaagactatttaaatgatagaaaatatgaacat
ttagatagaagagttatgcctgaatcagaaagtttgaaagacactttaattagggtgatt
ccttattggaacgaccaaatttcacaacagttattagatggaaaaactgtgcttgtttct
gcacatggaaattcattacgtgcattaattaagtatttagaagatgtatcagatgaagat
attgtaggatatgaaattaaaactggagcgcctttgatttatgatttaacagatgattta
aaagtaataaataaatattacttatag

DBGET integrated database retrieval system