KEGG   Staphylococcus cohnii: BZ166_08295Help
Entry
BZ166_08295       CDS       T05008                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
scoh  Staphylococcus cohnii
Pathway
scoh00010  Glycolysis / Gluconeogenesis
scoh00053  Ascorbate and aldarate metabolism
scoh00071  Fatty acid degradation
scoh00280  Valine, leucine and isoleucine degradation
scoh00310  Lysine degradation
scoh00330  Arginine and proline metabolism
scoh00340  Histidine metabolism
scoh00380  Tryptophan metabolism
scoh00410  beta-Alanine metabolism
scoh00561  Glycerolipid metabolism
scoh00620  Pyruvate metabolism
scoh00625  Chloroalkane and chloroalkene degradation
scoh01100  Metabolic pathways
scoh01110  Biosynthesis of secondary metabolites
scoh01120  Microbial metabolism in diverse environments
scoh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZ166_08295
   00053 Ascorbate and aldarate metabolism
    BZ166_08295
   00620 Pyruvate metabolism
    BZ166_08295
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BZ166_08295
   00561 Glycerolipid metabolism
    BZ166_08295
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BZ166_08295
   00310 Lysine degradation
    BZ166_08295
   00330 Arginine and proline metabolism
    BZ166_08295
   00340 Histidine metabolism
    BZ166_08295
   00380 Tryptophan metabolism
    BZ166_08295
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BZ166_08295
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BZ166_08295
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BZ166_08295
Enzymes [BR:scoh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BZ166_08295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh PSK_trans_fac VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AQM41475
UniProt: A0A3A0JLN6
LinkDB All DBs
Position
1751028..1752458
Genome map
AA seq 476 aa AA seqDB search
MRNFTKQYIDGEWVESASGETLDVINPATEEVAGTIAKGNKEDVNKAVEAADKVYLEFRQ
SSVAERKELLDKIVQEYKNRKDDIVDAITDELGAPLKVSENVHYQMGLNHFEAARDALDN
FEFEERRGDDLVVKEAIGVAGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGQGVGNPLSEHPKVRMMSFTGSGPTGASIMKKAAEDFK
KVSLELGGKSPYIILDDADIDGAASAATGKVVNNTGQVCTAGTRTLVPASIKEEFLTAVK
EKFSQVKVGDPREEGTQVGPIISKKQFDQVQSYIDKGVEEGAELLYGGPGKPENLEKGYF
ARPTIFNNVENDMTIAQEEIFGPVMSVITYNDLDEAIEIANDTKYGLAGYVYGQDKEKLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYFNA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacaatatatcgacggagaatgggtagaaagtgcaagtggagaa
acacttgatgtaatcaacccagcaactgaagaagtggcaggcacaattgctaaaggcaat
aaagaggatgttaataaagcggtagaagcagcagataaagtatatttagaatttagacaa
agttctgtagcagaaagaaaagaactgttagataaaattgttcaagaatataaaaataga
aaagatgatattgttgacgcaataactgacgaattaggagctcctttaaaagtatctgaa
aatgtccattatcaaatgggattaaatcattttgaagctgcacgagatgcattagataat
tttgaatttgaagaaagacgtggcgacgatttagttgttaaggaagcaattggtgttgct
ggattaattacaccatggaatttcccaactaaccaaacttcattaaaattagcagcagct
tttgcggcaggaagcccagttgtattaaaaccatcagaagaaacaccatttgcagccatc
attttagcagaaatatttgataaagttggcgtacctaaaggtgtatttaacttagtgaat
ggtgatggccaaggcgttggaaatccactaagtgaacatccaaaagtaagaatgatgtcc
tttactggatctggtccaactggtgcaagcattatgaagaaagcagctgaagatttcaaa
aaagtatcattagaattaggaggtaaatctccttatattattttagatgatgctgatatt
gatggtgctgcaagtgcagcaactggtaaagtcgtcaataatacaggacaagtttgtact
gcagggactagaacattggtaccagcaagtataaaagaagaattcttaacagctgttaaa
gaaaaatttagccaagttaaagttggtgatcctcgtgaagaaggtacacaagtaggacca
attattagtaaaaaacaatttgatcaagttcaatcatatattgataaaggtgtagaagaa
ggtgccgaattattatacggtggtcctggaaaacctgaaaacttggaaaaaggctatttt
gcaagaccaactatttttaataatgttgaaaatgatatgacaattgcacaagaagaaatt
ttcggtcctgttatgtctgtgatcacttacaacgatttagacgaagcaattgaaattgca
aatgatacgaaatatggcttagctggttatgtatatggacaagacaaagaaaaactgcat
aaagttgcgcgttcaattgaggctggaacagttgaaataaatgaagctggacgaaaacca
gacttaccattcggtggctataaacaatcaggtttaggacgcgaatggggagattatggc
atagaagaattcttagaagttaaatctattgcaggatattttaacgcgtaa

DBGET integrated database retrieval system