KEGG   Staphylococcus cohnii: BZ166_08915Help
Entry
BZ166_08915       CDS       T05008                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
scoh  Staphylococcus cohnii
Pathway
scoh00970  Aminoacyl-tRNA biosynthesis
scoh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scoh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BZ166_08915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:scoh03029]
    BZ166_08915
Enzymes [BR:scoh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BZ166_08915
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BZ166_08915
Mitochondrial biogenesis [BR:scoh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BZ166_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey MOZART1 YqeY
Motif
Other DBs
NCBI-ProteinID: AQM41565
UniProt: A0A3A0MS38
LinkDB All DBs
Position
1877753..1879180
Genome map
AA seq 475 aa AA seqDB search
MHFETVIGLEVHVELKTESKMFSPSPAHFGAKPNSNTNVIDLAYPGVLPVVNRRAVDWAM
RASMALNMDIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITR
LHMEEDAGKSTHKDGYSLVDLNRQGTPLIEIVSEPDIRSPQEAYAYLEKLRSIIQYTGVS
DCKMEEGSLRCDANISLRPYGQEEFGTKAELKNLNSFTYVRKGLEYEEKRQEEELLNGGE
ILQETRRFDEATGKTNLMRVKEGSDDYRYFPEPDIVPLYVDDEWKERVRQTIPELPDERK
DKYVNQFGLPAYDAHVITLTKEMSDFFEGAVAEGADVKLTSNWLMGGVNEYLNKHQIELL
DTKLTPQNLAGMIKLIEDGTMSSKIAKKVFPELAENGGDAKQIMEDKGLVQISDEATLLK
FVNEALDNNPQSVEDYQNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgaaacagttattggactagaggtccatgttgagttaaaaacagaatctaaa
atgttttctccatcaccagcacatttcggagcaaaacctaactcaaacacaaacgtcatt
gatttggcttaccctggtgtattaccggttgtcaatagacgtgcggttgattgggcgatg
agagcatcaatggcattaaatatggatattgcaacagaatcaaaatttgatcgtaaaaac
tatttctatccagataatcctaaagcatatcaaatttcacaatttgatcagccaattggt
gaaaatggttatattgatattgaagtagatggtgaaacgaaacgtataggtatcacacgt
ttacacatggaagaagatgctggtaagtcaacgcataaggatggttattcactagttgac
ttaaatagacaaggtacaccattgattgaaattgtatctgaaccagatattcgctcacca
caagaagcgtatgcatacttagaaaaattgcgttcaatcatacaatatactggtgtctct
gattgtaaaatggaagaaggatcattgcgttgtgatgctaatatttctttacgaccatat
ggtcaagaagaatttggaacaaaagcagaattgaaaaatttaaactcatttacttatgta
cgtaaagggttagaatatgaagaaaaacgtcaagaagaagaattattgaacggcggagag
attttacaagaaacgagacgttttgatgaagctacaggtaaaacgaatcttatgcgtgta
aaagaaggttctgatgattaccgttacttcccagaaccagatattgtgcctttatatgtt
gacgatgaatggaaagaacgcgtacgtcaaacaatacctgaattaccagatgaaagaaaa
gataaatacgtcaatcaatttggtttaccagcatatgatgcacatgtgattacattgaca
aaagaaatgtctgatttctttgaaggtgcagtagctgaaggtgcagatgtaaaattaact
tcaaactggttaatgggcggcgttaatgagtatttaaataaacatcaaatagaattatta
gatactaaacttacaccacaaaatcttgcaggtatgattaagttgattgaagatggcaca
atgagtagtaaaatcgctaaaaaagttttcccagaactagctgaaaatggtggagatgcc
aaacaaattatggaagataaaggcttagttcaaatctctgatgaagcaacactgcttaaa
tttgtaaatgaagcgttagacaacaatccacaatccgttgaagattatcaaaatggtaag
ggtaaagctatgggcttcttagttggtcaaattatgaaagcttccaaaggtcaagctaac
ccacaattagtgaaccaattattaaaacaagaattagataaaagataa

DBGET integrated database retrieval system