KEGG   Streptococcus constellatus subsp. pharyngis C232: SCRE_0415Help
Entry
SCRE_0415         CDS       T02833                                 

Gene name
pkn
Definition
(GenBank) putative serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
scon  Streptococcus constellatus subsp. pharyngis C232
Brite
KEGG Orthology (KO) [BR:scon00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scon01001]
    SCRE_0415 (pkn)
Enzymes [BR:scon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SCRE_0415 (pkn)
Protein kinases [BR:scon01001]
 Serine/threonine kinases: Other
  Bacterial family
   SCRE_0415 (pkn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kdo Kinase-like Pkinase_fungal FTA2 DUF908
Motif
Other DBs
NCBI-ProteinID: AGU72276
LinkDB All DBs
Position
408089..409972
Genome map
AA seq 627 aa AA seqDB search
MIQVGKIFAGRYRIIKQIGRGGMADVYLAKDLILDGEEVAVKVLRTNYQTDPIAVARFQR
EARAMADLDHPHIVRITDIGEEEGQQYLAMEYVAGLDLKRYIKEHAPLSNEEAVRIMGQI
LLAMRLAHTHGIVHRDLKPQNVLLTPDGDAKVTDFGIAVAFAETSLTQTNSMLGTVHYLS
PEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPNVP
QPLENVVIKATAKKLTDRYQSVAEMYVDLSSCLSADRRNEKKLVFDDTAKADTKTLPKVS
QNTLISASKPTTPTPIKETVSSNSQPTTKPKTKKKRRLRTRYKVLLSAVVLVIAALVALV
YLSPSNVKIPDVTGKTVAQARSAIEAAGLKVGKEKDEYSDSAKKDSVIRTNPQAGTQRRE
GSTVDLIVSKGPKTFTMEDYSGQKKADAINSLVQKYKVSKGLIKIEEVESSDYAAGTVVS
QTPAAGSTYDLTSKNRITLKVAKTVSSVTMPSYIGSTYEFAYNNLTEVIGVQGANVEKRI
VTTAPAGTQAHTIIKQSPEAKRPLNLKNDRIVLYVYEPKTEESSTSESSSQSGSSSNKNS
PSSSSSSSSGNDGSSSKTPDTSASASN
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagtcggcaagatatttgccgggcgatatagaatcatcaaacaaattgggcga
ggtggcatggcagatgtttacttggccaaagatttgattttagacggggaagaagtcgcg
gtgaaagttctaagaacgaattaccagacggatccgattgctgtggcgcgctttcaaaga
gaggcgcgagcgatggcagacttggatcatcctcatattgtccggattaccgatattgga
gaagaagaaggtcagcaatatctagcaatggagtatgtggctgggcttgacttaaaacgc
tatattaaagagcatgctcctttatctaatgaagaagcggttcggattatgggacaaatt
cttttggcaatgcgtttggcgcatacgcatggaattgttcatcgtgatttgaagccacaa
aatgtccttttaactccagatggcgatgcaaaagtaacggactttggaattgcagtagct
tttgctgaaacgagcctgacgcaaacaaattcaatgctgggaactgtgcattatctatca
ccagaacaagcgcgtggttcaaaagcgaccgttcaaagcgatatttacgctatggggatc
attttctatgaaatgttgacaggacatatcccttatgatggggatagtgctgtcacaatt
gctttgcaacatttccaaaagcctcttccttctgtgattgctgaaaatccaaatgtgcca
cagcctctagaaaatgtagtcatcaaggcaacggctaaaaaattaacagatcgttatcaa
tctgttgcagaaatgtatgtggatttatcaagctgcttatccgcagatcgccgaaatgag
aaaaagttggtttttgatgatactgccaaagcagataccaagacgcttcctaaagtgtca
caaaataccttaatttctgcaagcaaaccaactactcctacgcctataaaagaaacagtc
agtagtaattctcaacccacaaccaagccaaaaacaaagaaaaaacgtcgtttaagaacg
cgttataaagtgttgttgtcggcagtagtcttagttattgcagctttggtggctttagtc
tatttgagtccctcaaatgtaaaaataccagatgttactggaaaaaccgttgcgcaagca
cgttccgcgattgaagctgcaggtttgaaagttggcaaggagaaagacgaatacagtgat
tctgctaagaaagattctgtcattcgtacgaatccacaagcgggaacacaacgtcgcgaa
ggaagcacagtagatttgattgtctcaaaagggccgaaaacatttactatggaagattat
agcggtcaaaaaaaagcagatgctatcaacagtttggtgcaaaaatacaaagtttcaaag
ggcttgattaaaattgaagaagtagaaagtagtgactatgcagcaggaactgttgttagt
cagacgcctgcagcaggtagtacgtatgatttgacttcaaaaaatcggattacgttaaaa
gtagcgaagacggtttcaagtgttacaatgccaagttatataggttccacttatgaattt
gcctataataaccttaccgaagttattggcgttcaaggagctaatgttgaaaaacgaata
gttacaacagctccagcaggaacacaggcacacacgattattaaacaaagcccagaagca
aagaggcctctaaatttaaaaaatgatcgtattgtcttatatgtatatgagccaaaaact
gaagaatcatctacatctgaaagtagttcgcaatctggaagcagttcaaataaaaatagt
ccatcatctagtagttcgtcgagtagcggtaacgatggatcaagttcgaaaacaccagac
acaagcgctagtgcaagtaattaa

DBGET integrated database retrieval system