KEGG   Streptococcus constellatus subsp. pharyngis C232: SCRE_0865Help
Entry
SCRE_0865         CDS       T02833                                 

Gene name
acoC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scon  Streptococcus constellatus subsp. pharyngis C232
Pathway
scon00010  Glycolysis / Gluconeogenesis
scon00020  Citrate cycle (TCA cycle)
scon00620  Pyruvate metabolism
scon01100  Metabolic pathways
scon01110  Biosynthesis of secondary metabolites
scon01120  Microbial metabolism in diverse environments
scon01130  Biosynthesis of antibiotics
scon01200  Carbon metabolism
Module
scon_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCRE_0865 (acoC)
   00020 Citrate cycle (TCA cycle)
    SCRE_0865 (acoC)
   00620 Pyruvate metabolism
    SCRE_0865 (acoC)
Enzymes [BR:scon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SCRE_0865 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AGU72707
LinkDB All DBs
Position
complement(880895..881980)
Genome map
AA seq 361 aa AA seqDB search
MLPRPMNYLRMREIMDDKKLRATPAARKLADDLGINLYDVSGSGSNGRVHKEDVETYQDT
HAVRISPLAKRIAEEHNIAWNEIQGTGHRGKIMKKDVLAFLPENVESDSIKSPAVIEKVE
EVPDNITPYGEIERIPMTPMRKVIAQRMVDSYLTAPTFTLNYDVDMTEMLALRKKVIDPI
MEATGKKVTVTDLLSLAVVKTLMKHPYLNSSLTEDGKTIITHNYVNLAMAVGMDNGLMTP
VVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMLGVQSFGPIINQPN
SAILGVSATIEKPVALNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISML
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctcgaccaatgaattatttaagaatgagagagatcatggatgacaaaaaatta
agagcgacccctgcagctagaaagctggcagacgatctgggaatcaatctttacgatgtt
tccggttcaggctcaaacggtcgcgtccacaaggaagacgtggaaacctatcaagatacc
catgcggttcggatttcaccgctggccaagcgcattgccgaggagcacaatatcgcctgg
aatgagattcagggaactgggcaccgcggcaagattatgaagaaggatgtcctggccttc
ttgcctgaaaatgtcgaaagtgacagcatcaagtcgccggctgttattgaaaaggttgaa
gaagtaccagataatatcacgccttacggtgagattgagcgtattccaatgacaccgatg
cgcaaggttatcgcccaacggatggtggattcctatctgacggcgccgacctttaccctc
aactatgatgtggatatgacggaaatgctggccctacgcaagaaggttatagatccaatc
atggaagcgaccggcaagaaggtgacggtcacagatttgctgtcgttggctgtggttaag
accctgatgaagcacccttatctcaattcctctctgaccgaggacggcaagaccatcatc
acccacaactatgtcaatctggccatggctgtcggtatggataatggtctcatgacgcct
gtagtctacaatgctgagaagatgagcctgtctgagctagttgtggccttcaaggatgtc
atcggccggaccctggatggcaagctggcaccgagcgagctgcaaaattctaccttcacc
atcagcaatctgggcatgcttggtgtccaatcctttggcccgattatcaatcagcctaac
tcggccatcttgggtgtcagtgccactattgagaaacctgttgccctgaacggagaaatt
gtcatccggccgattatgagcctgggactgaccattgaccaccgggtcgtcgacggtatg
gctggagctaagtttatgaaggacctgaaagctttgattgaagatccaatctccatgttg
gtctaa

DBGET integrated database retrieval system