KEGG   Streptococcus constellatus subsp. pharyngis C232: SCRE_1532Help
Entry
SCRE_1532         CDS       T02833                                 

Gene name
aspC
Definition
(GenBank) putative aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
scon  Streptococcus constellatus subsp. pharyngis C232
Pathway
scon00220  Arginine biosynthesis
scon00250  Alanine, aspartate and glutamate metabolism
scon00290  Valine, leucine and isoleucine biosynthesis
scon01100  Metabolic pathways
scon01110  Biosynthesis of secondary metabolites
scon01130  Biosynthesis of antibiotics
scon01210  2-Oxocarboxylic acid metabolism
scon01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCRE_1532 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    SCRE_1532 (aspC)
   00220 Arginine biosynthesis
    SCRE_1532 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scon01007]
    SCRE_1532 (aspC)
Enzymes [BR:scon01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCRE_1532 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     SCRE_1532 (aspC)
Amino acid related enzymes [BR:scon01007]
 Aminotransferase (transaminase)
  Class I
   SCRE_1532 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGU73332
LinkDB All DBs
Position
complement(1553203..1554417)
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSTKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKNIPNVDIEDVYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEQADWYPDIEDIKSKITSNTKAIVVINPNNP
TGALYPKEVLEYLVEIARQNNLIIFADEIYDRLVMDGEKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKSHVKDYIEGLNMLSNMRLCSNVLSQHVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINEIPGLSATKPKAGLYIFPKIDREMYQVDDDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataaatcgacaaagttagaacatgtagcttatgatattcgtggtcca
gtcctagaagaagccatgcgaatgcgtgcaaatggtgagaagatcctccgtttgaataca
ggaaatcctgccgaatttggttttacggcaccagatgaagtgattcatgatttgattatg
aatgcacgggatagcgagggctattcagactcgaaaggaattttttctgctcggaaagcc
attatgcagtattgtcagttgaagaatattccaaatgtcgatattgaggacgtttatctt
ggtaatggggttagcgagctgattgttatgtcaatgcagggcttgctggataatggggac
gaagttctagtgccaatgcctgattatccgctctggacagctgctgttagcttagcagga
ggcaatgcggttcattatctttgtgatgagcaggcggattggtatccagatatagaagat
atcaaatcaaagattacttctaatacaaaggctattgtcgttatcaatccaaacaatccg
accggtgccttgtaccctaaggaagtcctagaatatcttgttgaaattgcacgacaaaat
aacttgattatttttgcggatgagatttatgaccgtttagtgatggatggtgagaaacat
acagcgattgctagtctggcaccggatcttttctgcgtcagcatgaacggtttgtctaaa
tcgcaccgtatcgcaggttttcgcgtaggctggatggtgctttcaggtccaaaatctcat
gtgaaagattatatcgaaggactgaatatgctgtcaaatatgcgtttgtgctcaaacgtc
ttatctcagcatgtggtccaaacatctcttggaggttatcagtcagtagacgaattgtta
cttcctggtggtcgcatttatgagcaacggaattttatttacaaggctatcaatgaaatt
ccaggtttgtctgcgaccaaacctaaagcaggactgtatatttttccaaaaattgataga
gaaatgtatcaagtggatgatgacgaacaattcgtgctggatttcttaaagcaagaaaag
attttgctggtgcacggacgcggatttaattggaaagacccagatcatttccgtatcgtt
tatctgccacgtgtagatgaattagcacagatccaagaaaagatgacgcgtttcttaagg
caatatcgaagataa

DBGET integrated database retrieval system