KEGG   Streptococcus constellatus subsp. pharyngis C232: SCRE_1670Help
Entry
SCRE_1670         CDS       T02833                                 

Gene name
tkt
Definition
(GenBank) putative transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
scon  Streptococcus constellatus subsp. pharyngis C232
Pathway
scon00030  Pentose phosphate pathway
scon01100  Metabolic pathways
scon01110  Biosynthesis of secondary metabolites
scon01120  Microbial metabolism in diverse environments
scon01130  Biosynthesis of antibiotics
scon01200  Carbon metabolism
scon01230  Biosynthesis of amino acids
Module
scon_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
scon_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:scon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCRE_1670 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    SCRE_1670 (tkt)
Enzymes [BR:scon01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     SCRE_1670 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: AGU73464
LinkDB All DBs
Position
complement(1713254..1715230)
Genome map
AA seq 658 aa AA seqDB search
MSNLSVNAIRFLGIDAIEKSKSGHPGVVMGAAPMAYDLFTKQMRINPEVPNWINRDRFVL
SAGHGSMLLYALLHLSGFKDVTMEEIKNFRQWGSKTPGHPEFGHTAGVDATTGPLGQGIS
MATGFAQAERFLAAKYNREGYNIFNHYTYVICGDGDLMEGVSAEAASYAGLQKLDKLIVL
YDSNDINLDGETKDSFTESVRDRYNAYGWHTALVKDGTDLEAINAAIEAAKVSGKPSLIE
VKTVIGYGSPNKQGTNAVHGAPLGAEEVAATRKALAWDYAPFEIPEEVYEDYRVNVAERG
KAAYDVWEKLVEEYKQAYPDLADEVAAIIAGKDPVEIKPEDFPVKETGLSQATRNSSQDA
LNAAAKVLPTFLGGSADLAHSNMTYIKEDGLQDDAHRLNRNIQFGVREFAMGTILNGMAL
HGGLRVYGGTFFVFSDYVKAAVRLSALQGLPVTYVFTHDSIAVGEDGPTHEPIEHLAGLR
AIPNLTVFRPADARETQAAWYLALKSKTTPTALVLTRQNLTVEAETDFNKVAKGAYVVYE
TVGGFDTILLASGSEVNLAVAAAKELEVQGEKVRVVSVPSTDIFDAQDVAYKEEILPNAV
RRRVAIEMAATQSWYKYVGLDGSVIGIDKFGASAPAAKVMKEYGFTVEHIVEVVKNLK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatttatctgtcaacgccattcgttttttaggaattgatgccattgaaaaatca
aaatctggtcacccaggtgttgtcatgggcgcagctccgatggcttatgacttgtttacc
aagcaaatgcgcatcaatccagaagtgccaaattggatcaatcgcgatcgttttgtttta
tcagctggtcacggctctatgttactctatgcccttctccatttgtctggttttaaagat
gtcacaatggaagaaatcaagaacttccgtcaatggggttctaaaacgcctgggcatccc
gaatttggacatactgctggtgtagatgcgacaactggtccacttggtcaaggaatttct
atggcaactggttttgcacaagcagaacgttttttagcagcaaaatacaatcgtgaaggc
tataatatctttaaccactatacctatgtcatctgtggtgacggggacttaatggaaggt
gtgtctgctgaagcggcttcttatgctggactgcaaaagctagataagctcatcgttctc
tatgattcaaacgacatcaatttggacggagaaacgaaagattcctttacagaaagtgtt
cgtgaccgttacaatgcttacggctggcacacagctttggtcaaagacggaacagactta
gaagcaatcaatgcggcgattgaagccgcaaaagtttctggcaaaccttccttgattgaa
gtcaaaacggtgattggttatggctcaccaaataaacaagggacaaatgctgttcatgga
gcgcctcttggtgcggaagaagtagcggctactcgcaaagcccttgcttgggattacgca
ccatttgaaattccagaagaagtctacgaagattatcgagttaatgttgcagaacgcggc
aaagctgcctatgatgtttgggaaaaactcgttgaagaatacaaacaagcctatcctgac
ttagctgatgaagttgctgccattattgctggaaaagatccagttgagatcaaaccagaa
gatttcccagtaaaagaaacaggtctttcacaagctactcgtaattctagccaagatgct
ttgaatgctgccgcaaaagttctcccaactttccttggtggctctgctgacctcgctcat
tctaatatgacttacatcaaagaagatggcttgcaagatgatgcccaccgtcttaaccgc
aatattcaattcggtgtgcgtgaatttgctatgggtactattttgaatggtatggcactt
cacggaggacttcgtgtttatggcggtacgttctttgtcttctcagactatgttaaagcg
gctgttcgcttatcagcccttcaaggcttacctgtgacttatgtctttacgcatgactca
attgcagttggtgaggatggtccaactcatgaaccaattgagcatttagctggacttcgt
gctattccgaatctcactgttttccgtccagcggatgcgcgtgaaacacaggcggcttgg
tacttggcactgaaaagtaaaacaactccaacggcgttggttcttactcgtcaaaacttg
actgttgaagctgaaactgactttaacaaggtagcaaaaggcgcttatgtggtgtatgaa
acagtaggtggttttgatacaattcttcttgcatctggttctgaagtcaacttagctgtt
gcagctgcaaaagagttggaagtacaaggggaaaaagttcgcgttgtcagtgtaccatca
acagacatctttgatgcacaagacgttgcttacaaagaagaaattctaccaaatgcagtc
cgccgccgtgttgccattgaaatggctgcaacccaatcttggtacaaatatgttggactt
gacggttctgttatcggtattgataaattcggtgcttctgctccagcagctaaagtaatg
aaagagtacggtttcacagttgaacatatcgttgaggttgtgaaaaacttgaaataa

DBGET integrated database retrieval system