KEGG   Streptococcus constellatus subsp. pharyngis C818: SCR2_0865Help
Entry
SCR2_0865         CDS       T02834                                 

Gene name
acoC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scos  Streptococcus constellatus subsp. pharyngis C818
Pathway
scos00010  Glycolysis / Gluconeogenesis
scos00020  Citrate cycle (TCA cycle)
scos00620  Pyruvate metabolism
scos01100  Metabolic pathways
scos01110  Biosynthesis of secondary metabolites
scos01120  Microbial metabolism in diverse environments
scos01130  Biosynthesis of antibiotics
scos01200  Carbon metabolism
Module
scos_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCR2_0865 (acoC)
   00020 Citrate cycle (TCA cycle)
    SCR2_0865 (acoC)
   00620 Pyruvate metabolism
    SCR2_0865 (acoC)
Enzymes [BR:scos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SCR2_0865 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AGU74463
LinkDB All DBs
Position
complement(881124..882209)
Genome map
AA seq 361 aa AA seqDB search
MLPRPMNYLRMREIMDDKKLRATPAARKLADDLGINLYDVSGSGSNGRVHKEDVETYQDT
HAVRISPLAKRIAEEHNIAWNEIQGTGHRGKIMKKDVLAFLPENVESDSIKSPAVIEKVE
EVPDNITPYGEIERIPMTPMRKVIAQRMVDSYLTAPTFTLNYDVDMTEMLALRKKVIDPI
MEATGKKVTVTDLLSLAVVKTLMKHPYLNSSLTEDGKTIITHNYVNLAMAVGMDNGLMTP
VVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGMLGVQSFGPIINQPN
SAILGVSATIEKPVALNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISML
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctcgaccaatgaattatttaagaatgagagagatcatggatgacaaaaaatta
agagcgacccctgcagctagaaagctggcagacgatctgggaatcaatctttacgatgtt
tccggttcaggctcaaacggtcgcgtccacaaggaagacgtggaaacctatcaagatacc
catgcggttcggatttcaccgctggccaagcgcattgccgaggagcacaatatcgcctgg
aatgagattcagggaactgggcaccgcggcaagattatgaagaaggatgtcctggccttc
ttgcctgaaaatgtcgaaagtgacagcatcaagtcgccggctgttattgaaaaggttgaa
gaagtaccagataatatcacgccttacggtgagattgagcgtattccaatgacaccgatg
cgcaaggttatcgcccaacggatggtggattcctatctgacggcgccgacctttaccctc
aactatgatgtggatatgacggaaatgctggccctacgcaagaaggttatagatccaatc
atggaagcgaccggcaagaaggtgacggtcacagatttgctgtcgttggctgtggttaag
accctgatgaagcacccttatctcaattcctctctgaccgaggacggcaagaccatcatc
acccacaactatgtcaatctggccatggctgtcggtatggataatggtctcatgacgcct
gtagtctacaatgctgagaagatgagcctgtctgagctagttgtggccttcaaggatgtc
atcggccggaccctggatggcaagctggcaccgagcgagctgcaaaattctaccttcacc
atcagcaatctgggcatgcttggtgtccaatcctttggcccgattatcaatcagcctaac
tcggccatcttgggtgtcagtgccactattgagaaacctgttgccctgaacggagaaatt
gtcatccggccgattatgagcctgggactgaccattgaccaccgggtcgtcgacggtatg
gctggagctaagtttatgaaggacctgaaagctttgattgaagatccaatctccatgttg
gtctaa

DBGET integrated database retrieval system