KEGG   Streptococcus constellatus subsp. pharyngis C818: SCR2_1532Help
Entry
SCR2_1532         CDS       T02834                                 

Gene name
aspC
Definition
(GenBank) putative aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
scos  Streptococcus constellatus subsp. pharyngis C818
Pathway
scos00220  Arginine biosynthesis
scos00250  Alanine, aspartate and glutamate metabolism
scos00290  Valine, leucine and isoleucine biosynthesis
scos01100  Metabolic pathways
scos01110  Biosynthesis of secondary metabolites
scos01130  Biosynthesis of antibiotics
scos01210  2-Oxocarboxylic acid metabolism
scos01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scos00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCR2_1532 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    SCR2_1532 (aspC)
   00220 Arginine biosynthesis
    SCR2_1532 (aspC)
Enzymes [BR:scos01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCR2_1532 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     SCR2_1532 (aspC)
Amino acid related enzymes [BR:scos01007]
 Aminotransferase (transaminase)
  Class I
   SCR2_1532 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AGU75086
LinkDB All DBs
Position
complement(1553451..1554665)
Genome map
AA seq 404 aa AA seqDB search
MKEFNKSTKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKNIPNVDIEDVYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYLCDEQADWYPDIEDIKSKITSNTKAIVVINPNNP
TGALYPKEVLEYLVEIARQNNLIIFADEIYDRLVMDGEKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKSHVKDYIEGLNMLSNMRLCSNVLSQHVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINEIPGLSATKPKAGLYIFPKIDREMYQVDDDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAQIQEKMTRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttaataaatcgacaaagttagaacatgtagcttatgatattcgtggtcca
gtcctagaagaagccatgcgaatgcgtgcaaatggtgagaagatcctccgtttgaataca
ggaaatcctgccgaatttggttttacggcaccagatgaagtgattcatgatttgattatg
aatgcacgggatagcgagggctattcagactcgaaaggaattttttctgctcggaaagcc
attatgcagtattgtcagttgaagaatattccaaatgtcgatattgaggacgtttatctt
ggtaatggggttagcgagctgattgttatgtcaatgcagggcttgctggataatggggac
gaagttctagtgccaatgcctgattatccgctctggacagctgctgttagcttagcagga
ggcaatgcggttcattatctttgtgatgagcaggcggattggtatccagatatagaagat
atcaaatcaaagattacttctaatacaaaggctattgtcgttatcaatccaaacaatccg
accggtgccttgtaccctaaggaagtcctagaatatcttgttgaaattgcacgacaaaat
aacttgattatttttgcggatgagatttatgaccgtttagtgatggatggtgagaaacat
acagcgattgctagtctggcaccggatcttttctgcgtcagcatgaacggtttgtctaaa
tcgcaccgtatcgcaggttttcgcgtaggctggatggtgctttcaggtccaaaatctcat
gtgaaagattatatcgaaggactgaatatgctgtcaaatatgcgtttgtgctcaaacgtc
ttatctcagcatgtggtccaaacatctcttggaggttatcagtcagtagacgaattgtta
cttcctggtggtcgcatttatgagcaacggaattttatttacaaggctatcaatgaaatt
ccaggtttgtctgcgaccaaacctaaagcaggactgtatatttttccaaaaattgataga
gaaatgtatcaagtggatgatgacgaacaattcgtgctggatttcttaaagcaagaaaag
attttgctggtgcacggacgcggatttaattggaaagacccagatcatttccgtatcgtt
tatctgccacgtgtagatgaattagcacagatccaagaaaagatgacgcgtttcttaagg
caatatcgaagataa

DBGET integrated database retrieval system