KEGG   Salinivibrio costicola: HBA18_14105
Entry
HBA18_14105       CDS       T06511                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
scot  Salinivibrio costicola
Pathway
scot00473  D-Alanine metabolism
scot00550  Peptidoglycan biosynthesis
scot01100  Metabolic pathways
scot01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:scot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HBA18_14105
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HBA18_14105
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HBA18_14105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:scot01011]
    HBA18_14105
Enzymes [BR:scot01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HBA18_14105
Peptidoglycan biosynthesis and degradation proteins [BR:scot01011]
 Precursor biosynthesis
  Amino acid ligase
   HBA18_14105
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A
Other DBs
NCBI-ProteinID: QIR07931
UniProt: A0A6G9Q1H3
LinkDB
Position
2:complement(147583..148587)
AA seq 334 aa
MSKINLLLLCGGGGAEHAISLISAQYLESQLAKMPRVKVHKVEMTDQGWHLADGMRCHLD
TDGMLCSKVEHTQIHYVVPCIHGFPGETGDIQSLLEITGLPYLGCGPEASRVCFNKITSK
LWFDALGIPNTPYVFLTDQSPSSLTRARTFYDEQGAVFVKAASQGSSVGCYRVAKEDELE
ARIADAFTFSDQVLIEKAIKPRELEVAAFHMGEDVIVTPPGEISCPEDTFYTYEEKYSDG
SHSNTHIEAANLTDEQIEAIQQYARQAFVHLRLKDLSRIDFFLSDDNQILLNEINTFPGM
TPISMFPKLVEHHGYPFHEYLAQCISKATGKRVI
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgagtaaaataaaccttcttttgctgtgtggtggcggtggcgctgaacatgcgatttct
ttgatttcggctcagtatcttgagtcacaactggcaaaaatgccgcgagtgaaagtccat
aaagtggaaatgaccgatcaaggttggcatttagcggatggcatgcgctgccatttggat
accgatggcatgctgtgtagcaaggtagaacacacccaaatccattatgtggtgccttgt
attcacggctttcccggtgagacaggcgatattcaatcattattagaaatcacaggtttg
ccgtatctcggctgcggacctgaagcgagccgagtgtgctttaataaaatcacctccaag
ttatggtttgacgccctcgggattccgaacacaccttatgtatttttaaccgatcaaagc
ccaagtagcttgactcgggcacgtactttttatgacgagcaaggggcggtttttgtaaaa
gcggcaagtcagggctccagcgtgggctgctaccgtgtggcgaaagaagatgagctagaa
gcgcgaattgcagatgcgtttacgttttcagaccaagtacttatcgagaaagcgattaaa
ccacgtgagcttgaagtcgctgcattccacatgggagaggatgtgattgtcaccccaccg
ggcgaaatcagctgtcctgaggacaccttctacacctacgaggaaaagtacagcgatggc
agtcacagcaatacgcacattgaagcggcaaacctcacggatgaacaaatagaggcgatt
cagcagtatgcgcgtcaagcgtttgtgcacctacgcttaaaagacttgtctcgtattgac
ttctttttgagtgacgataaccaaatcttacttaatgaaatcaataccttcccaggaatg
accccgatttcgatgttcccaaaattggtagaacatcatggttatcctttccacgaatac
ctcgcccaatgtattagcaaggcaacaggcaaacgggtgatttag

DBGET integrated database retrieval system