KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10177Help
Entry
HMPREF0833_10177  CDS       T01545                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Brite
Enzymes [BR:scp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HMPREF0833_10177 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEH55208
UniProt: F8DFD3
LinkDB All DBs
Position
176109..176714
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPYIDEETMHLHHDKHHQTYVNNVNAALEKHPEIGEDLESLLADV
ESIPADIRQAVINNGGGHLNHALFWELMTPEQTAPSAELAAAIDATFGSFEDFKAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPLSEGKTPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVNELFVAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctatcattttaccagaattaccatatgcttatgatgcattggaaccttatatcgat
gaagaaaccatgcatttgcaccatgataaacaccatcaaacatatgtaaacaatgttaat
gcagctcttgaaaaacatcctgaaattggagaagaccttgaaagcttgttagctgatgtt
gaatccattccagctgacattcgccaagctgtaatcaacaatggtggtggtcatttgaac
catgctcttttctgggaattgatgactccagaacaaacagctccttcagcagaacttgct
gcagcgattgatgctacatttggttcatttgaagacttcaaagcagccttcacagcagca
gcaacgacacgttttggttctggctgggcatggttggttgtcaacaaagaaggcaaactc
gaagtgacttcaacagcaaatcaagatacaccgctctctgaaggtaaaacaccaatcctt
ggtttggatgtctgggaacacgcttactacgtgaaataccgtaacgtacgtcctgactac
atcaaagctttcttctcagtgatcaactggaataaagttaatgaattgtttgtagcagca
aaataa

DBGET integrated database retrieval system