KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11348Help
Entry
HMPREF0833_11348  CDS       T01545                                 

Gene name
hslO
Definition
(GenBank) chaperonin HslO
  KO
K04083  molecular chaperone Hsp33
Organism
scp  Streptococcus parasanguinis ATCC 15912
Brite
KEGG Orthology (KO) [BR:scp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:scp03110]
    HMPREF0833_11348 (hslO)
Chaperones and folding catalysts [BR:scp03110]
 Heat shock proteins
  HSP33
   HMPREF0833_11348 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 zinc_ribbon_4 Elf1
Motif
Other DBs
NCBI-ProteinID: AEH56379
UniProt: F8DKK4
LinkDB All DBs
Position
1438763..1439635
Genome map
AA seq 290 aa AA seqDB search
MDKIIKTISESGAFRAYVLDSTETVRTAQEKHHTQASSTVALGRTLIASQILAANEKGDT
KITVKVLGTSSLGAIITVADTKGNIKGYVQNPGVDIKKTATGEVLVGPFVGNGEFLVITD
YGTGNPYNSMTPLVTGEIGEDLAFYLTESQQTPSAVGLNVLLDEEDKVKVAGGFLLQVLP
NAKEEEIARFEKRIQEMPAISTLLESEDHIEALLAAIYGDEPFKRLSEEELRFQCDCSRE
RFLNALASLPASDLKEMKDEDHGAEITCQFCQTHYHFDENDLEELIRDKS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaattattaaaactatctcagaaagtggtgcttttcgtgcttatgtactagac
agtacagaaactgtacgaacagcccaagaaaaacatcatacacaagctagctccacggtc
gcacttggccgtaccctcattgccagccaaatcttggcggcaaacgagaaaggagatact
aaaattacggtcaaagtccttggaactagctcactcggagccatcatcaccgtggcagat
accaagggaaatattaaaggctacgtgcaaaatcctggagtggatatcaagaagactgcg
actggtgaagttctggtgggaccatttgtcggaaacggagaattcttggtcatcacagat
tatggtacgggaaatccttataactccatgacccctcttgtaaccggtgaaatcggagaa
gacctggccttttatctgacggaaagccaacaaacaccatctgcagttggactcaatgtt
cttttggatgaagaagacaaggtcaaggtggctggtggcttcttgctccaggtcttaccc
aatgccaaggaagaagaaatcgcgcgctttgaaaaacgcatccaagaaatgcctgccatc
tccacacttttggaatctgaagaccatattgaagctcttcttgccgctatctatggggat
gaacctttcaaacgcctctctgaagaagaacttcgctttcagtgcgactgcagccgtgag
cgtttcttgaacgctttagcaagtctgccagctagtgatttaaaagagatgaaagatgaa
gatcacggtgcagagattacctgccaattctgccaaacccactaccactttgacgaaaat
gacttggaggaactcattcgtgacaaatcttaa

DBGET integrated database retrieval system