KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_12016Help
Entry
HMPREF0833_12016  CDS       T01545                                 

Definition
(GenBank) putative serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Brite
KEGG Orthology (KO) [BR:scp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scp01001]
    HMPREF0833_12016
Enzymes [BR:scp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HMPREF0833_12016
Protein kinases [BR:scp01001]
 Serine/threonine kinases: Other
  Bacterial family
   HMPREF0833_12016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kdo Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AEH57047
UniProt: F8DIQ5
LinkDB All DBs
Position
2145034..2146902
Genome map
AA seq 622 aa AA seqDB search
MIQIGKIFAGRYKIIQQIGRGGMADVYLARDLILDGEEVAVKVLRTNYQTDPIAVARFQR
EAKAMAELDHPNIVRITDIGEEEGQQYLAMEYVAGLDLKRYIKENAPLSNEEAVRLMGQI
LLAMRLAHTRGIIHRDLKPQNVLLTPDGTAKVSDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSIREENKNVP
QALENVVIKATAKKLTDRYKSVAEMYVDLSSCLSYERRNEKKLVFEDQTKADTKTLPKVS
PTPKTAPVPISEVRSEISSVDPKRPLSNQQVVAPNKKPRRRLRARYKVLFVAIALVLAAF
TFLLYMSPANKTVPDVSGKTIAEARAIIEGQDLQVGEEKEEYSDTVAEGYVIRTNPNAGA
QKREQSRIDLIVSKGPNSFEMPNYVGETRAKAEDDLKNTYKVSSKMISIEEVETFDYDPG
TVIEQTPAAGEQYSLNSKTKIVLKVAKETTSIEMPNYIGSTYDFARSNLIEIYDIKEANI
ELRKTDHLPDGVVVSAGQIVSQTPEASNTVDINRTRIILTVYEPKVTSSSSTKASSSSET
SSSSSSDRKDTDSSSSSAADDD
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatcggcaaaatttttgccgggcgatataaaatcatccaacaaattgggcgc
ggcgggatggcagatgtttatcttgcgcgtgatttgattttagatggtgaagaagttgca
gtcaaggtactgcgtacgaattatcagacggatcccattgcagttgctcgttttcagcgg
gaagcaaaagcgatggcggaactggaccatccaaatatcgttcggattacagacattggc
gaagaagaagggcaacaataccttgcaatggaatatgttgcaggtttagacttgaaacgc
tatatcaaagaaaatgcacctttatcaaatgaagaagcggttcgtttgatgggacagatt
ctccttgctatgcgtctagcccatacgcgtggcattatccatagagatttaaaaccacag
aatgtcctcttgactccggatgggactgcaaaagtttcagactttgggattgcagtggcc
tttgcagagacaagcttgacccagaccaactctatgttaggatcagtccattatttgtca
cctgagcaggcacggggatcgaaagctacggttcaaagtgacatttacgctatgggaatt
attttctatgagatgttgactggacacattccttatgatggggatagtgcggttacgatt
gcactgcaacatttccaaaaacctcttccctctattcgtgaagaaaataagaatgttccg
caagctttagaaaatgttgtgatcaaagcgacggctaagaagctgacggaccgttataag
tcagtagcagagatgtatgtagatctttcaagctgcctgtcttatgagaggagaaatgag
aaaaagctggtttttgaagatcaaacaaaggctgatacaaaaactcttccgaaagtgagt
ccgactccaaagaccgctccagttccaatctctgaggtgcgcagtgaaatcagttcggtg
gatccaaaacggccattatccaaccagcaggtcgtggcaccaaataaaaagccaagaaga
cgcttacgtgcacgttataaagtattgtttgttgcaatcgcgctagttcttgctgccttt
accttcttgttgtatatgagtccagccaataaaacagttccggatgtttctggtaagact
attgctgaggccagagcgattatcgaaggtcaagatcttcaagttggtgaagaaaaggaa
gaatatagtgatactgttgcggaaggctatgtcattcgaactaatccaaatgcgggagct
caaaagagggaacaaagtcgaattgatttgattgtttcaaagggaccaaatagctttgaa
atgccaaattatgtaggagaaacgagggcaaaagcagaggatgatctgaaaaatacttat
aaagtgtcaagtaagatgatcagtatagaggaagttgaaacttttgactatgatcctggg
acggttattgagcaaacaccggcagcaggtgagcaatattctttgaattcaaaaactaag
attgtattaaaagtagcaaaagaaacaacttcaattgaaatgccaaactatattggatca
acctatgatttcgcacgtagcaatttgattgaaatatatgacatcaaggaagccaatatt
gaattaagaaaaacggaccatcttcctgatggggttgttgtttctgcagggcaaattgtg
agtcaaactcctgaggcatctaatacagtggatattaatcggaccagaattatattgaca
gtgtatgagcctaaagtgacttcttcttcaagtacgaaagcttcttcaagttcagaaacg
tctagttcgtcttcatcagatcgaaaggataccgatagttcaagtagtagtgcagcagat
gatgattag

DBGET integrated database retrieval system