KEGG   Spiroplasma culicicola: SCULI_v1c00030Help
Entry
SCULI_v1c00030    CDS       T03047                                 

Gene name
gyrB
Definition
(GenBank) DNA gyrase subunit B
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
scq  Spiroplasma culicicola
Brite
KEGG Orthology (KO) [BR:scq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:scq03032]
    SCULI_v1c00030 (gyrB)
   03400 DNA repair and recombination proteins [BR:scq03400]
    SCULI_v1c00030 (gyrB)
Enzymes [BR:scq01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     SCULI_v1c00030 (gyrB)
DNA replication proteins [BR:scq03032]
 Prokaryotic type
  DNA Topoisomerases
   SCULI_v1c00030 (gyrB)
DNA repair and recombination proteins [BR:scq03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      SCULI_v1c00030 (gyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3 TOPRIM_C
Motif
Other DBs
NCBI-ProteinID: AHI52344
UniProt: W6AF92
LinkDB All DBs
Position
2623..4524
Genome map
AA seq 633 aa AA seqDB search
MEKKYGASQIQVLEGLEAVRKRPGMYIGNTNKNGLHHMIWEILDNAVDESLAGFCDEITI
IMTEENEIIIKDNGRGIPVDLHPKTNKSTLETIFTVLHAGGKFDESTYKISGGLHGVGAS
VVNALSLYVEAIISRDNVLYHQKFYDGGTKATELKEIGISDSTGSIIKFKPDPEIFKETI
EFDFKVVQTKIKQLAFLNKGLKIELYDQKNDKFLSYRFDDGIKDYIKEINSGKEKINEEI
FYINDTYEKIEVEVSVQYNDTYDENIFSFCNNIFTSEGGSHEDGFKTSILRSLNTYTNEL
KNFKGNKFVFEDIKEGMCAVISIKHVDPLYEGQTKAKLSNPDAKDAVNNIVFESFKEFLL
KNPNDAKKIIDKILISQKARKAAQRAREDTRRKSAIDNFSLPGKLADCESKDANESELYL
VEGDSAGGSAKTGRNRKTQAILSLKGKVLNVEKVKQSKVFENNEIQSIIAAIGSGVKNDF
NIAKIRYKKIIIMTDADVDGAHIRVLLLTFFYRYMKELILNGNIYIAQPPLYKIDAGKNK
VDYAYSDQELEKLKNEKYKDTKYIIQRYKGLGEMDPIQLWETTMDPTRRTMLQIKVEDAF
MANEVFSSLMGESAELRRNFITENAQFVENIDI
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaatatggggctagtcaaattcaagttcttgaaggtttagaagctgtaaga
aaaagaccaggaatgtatattggaaatacaaacaaaaatggtttacatcatatgatatga
gaaattttagacaatgctgttgatgaatcattagcaggtttttgtgatgaaattacaatt
attatgacagaagaaaatgaaattattattaaagataatggaagaggaattccagttgat
cttcatcctaaaacaaataaaagtacattagaaactatttttactgttttacatgcagga
ggaaaatttgatgaatctacatataaaatttctgggggacttcatggagttggtgcttct
gtagttaatgctttgtcattatatgtagaagcaattatttcaagagacaatgttttatat
catcaaaaattttatgatggaggaactaaagcaactgaattaaaagaaattggaatttca
gattctactggttcaataattaaatttaaaccagatcctgaaatttttaaagaaacaatt
gaatttgattttaaagttgttcaaactaaaattaaacaacttgcatttttaaataaggga
ttaaaaattgaattatatgatcaaaaaaatgataaatttttatcttatagatttgatgat
ggaataaaagattatattaaagaaattaatagtggtaaagaaaaaattaatgaagaaatt
ttttatataaatgatacatatgaaaaaattgaagttgaagtttcagttcaatataatgat
acttatgacgaaaatattttttctttctgtaataatatttttacaagtgaaggtggatct
catgaagatggatttaaaacttcaattttaagatcattaaatacatatacaaatgaatta
aaaaattttaaaggtaataaatttgtttttgaagatattaaagaaggaatgtgtgcagtt
atttcaattaaacacgttgatcctttatatgaaggtcaaacaaaagcaaaattatcaaat
ccagatgcaaaagatgcagttaataatattgtatttgaatcatttaaagaatttttatta
aagaatccaaatgatgcaaaaaaaataattgataaaattttaatttcacaaaaagcaaga
aaagcagctcaaagagcaagagaagatacaagacgtaaatctgcaattgataatttttct
ttacctggtaaattagcagattgtgaatctaaagatgcaaatgaatctgaattatattta
gtcgaaggagattcagctgggggaagtgccaaaactggtagaaatagaaaaactcaagct
attctttctttaaagggaaaagttttaaatgttgaaaaagtaaaacaatctaaagttttt
gaaaacaatgagattcaatcaataattgctgcaattggatctggggttaaaaatgatttc
aatattgcaaaaattagatataaaaaaataatcataatgactgatgctgatgttgatggt
gcacatattagagttttattattaactttcttttatagatatatgaaggaattaatttta
aatggaaatatttatattgctcaaccaccattatataaaattgatgctggaaaaaataaa
gttgactatgcatattcagatcaagaattagaaaaattaaaaaatgaaaaatataaagat
acaaaatatataattcaaagatataaaggtcttggagaaatggatccaattcaattgtga
gaaacaacaatggatccaacaagaagaacaatgttgcaaattaaagttgaagatgcattt
atggcaaatgaagtattttctagcttaatgggtgaaagtgctgaattaagaagaaacttt
attactgaaaatgctcaatttgttgagaatattgatatttaa

DBGET integrated database retrieval system