KEGG   Spiroplasma chrysopicola: SCHRY_v1c06370Help
Entry
SCHRY_v1c06370    CDS       T02676                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scr  Spiroplasma chrysopicola
Pathway
scr00010  Glycolysis / Gluconeogenesis
scr00030  Pentose phosphate pathway
scr00051  Fructose and mannose metabolism
scr00052  Galactose metabolism
scr00680  Methane metabolism
scr01100  Metabolic pathways
scr01110  Biosynthesis of secondary metabolites
scr01120  Microbial metabolism in diverse environments
scr01130  Biosynthesis of antibiotics
scr01200  Carbon metabolism
scr01230  Biosynthesis of amino acids
scr03018  RNA degradation
Module
scr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCHRY_v1c06370 (pfkA)
   00030 Pentose phosphate pathway
    SCHRY_v1c06370 (pfkA)
   00051 Fructose and mannose metabolism
    SCHRY_v1c06370 (pfkA)
   00052 Galactose metabolism
    SCHRY_v1c06370 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    SCHRY_v1c06370 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SCHRY_v1c06370 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:scr01009]
    SCHRY_v1c06370 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:scr03019]
    SCHRY_v1c06370 (pfkA)
Enzymes [BR:scr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCHRY_v1c06370 (pfkA)
Protein phosphatases and associated proteins [BR:scr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCHRY_v1c06370 (pfkA)
Messenger RNA biogenesis [BR:scr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SCHRY_v1c06370 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-GeneID: 16152071
NCBI-ProteinID: AGM25213
UniProt: R4U3W9
LinkDB All DBs
Position
complement(700709..701689)
Genome map
AA seq 326 aa AA seqDB search
MIKRIGILTSGGDSQGMNAAISGVVKTAIAKGLEVYAVKDGYLGLVNDWIEPVGVNFADS
IINRGGTVLGTARLPEFKEVEVRQKAVANLKAKGIDALVVIGGDGSYQGAQKLTEMGINC
VALPGTIDNDITSTDYTIGFDTAINIVVEALDRIRDTIQSHNRCAIVEVMGHSCGDIALY
AGIAAGADIISINESALTEAEIASKVKEMHDKNKRSVIVVVSELIYPDLKKLARLVETTS
GYVTREAVLAHIQRGGTPTAMERYRAFQMAKFAVEQILAGIGGIAVGNVGDEIVARPIME
ALSIPRISRKDILADFTNLNDNIYKK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacggattggaattcttacttctggtggtgattcacagggaatgaacgccgct
attagtggagtagtaaaaactgcaattgctaaaggtttagaagtatatgcagtaaaagac
ggttatttaggattagttaatgactgaattgaaccagttggggttaattttgctgattca
attattaatcgtggtggaacagtgttaggaacagcgcgtttacctgaatttaaagaagtt
gaagttcgtcaaaaggctgttgccaatttaaaagcaaaaggaattgatgcattagttgtt
attgggggtgatggtagttaccaaggcgcccaaaaactaaccgaaatgggcatcaattgt
gttgctttaccaggaacaattgataatgatattacttcaacagactatacaattggtttt
gatacggcaattaatattgttgttgaagcccttgatcgcattcgtgatacaattcaatct
cataatcgttgtgcaattgttgaagtaatgggacattcatgtggtgatattgccttatat
gctggaattgccgccggagctgacattatttcaataaatgaatcagctttaacagaagca
gaaattgcttcaaaagttaaagaaatgcatgataaaaataaacgtagtgtaattgttgtt
gttagtgaactaatttaccctgatttaaaaaaattagcccgtttagtcgaaacaactagt
ggttatgtaactcgtgaagctgttttagcacatattcaaaggggaggaactccaacggcg
atggaacgctatcgcgctttccaaatggcaaaatttgcggttgaacaaattttagccgga
attgggggaattgctgttggtaatgttggggatgaaattgtcgctcgcccaattatggaa
gcattaagcattccccgcatctcacgcaaagatattttggctgattttactaatttaaat
gataatatctataaaaaataa

DBGET integrated database retrieval system