KEGG   Spiroplasma chrysopicola: SCHRY_v1c07740Help
Entry
SCHRY_v1c07740    CDS       T02676                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
scr  Spiroplasma chrysopicola
Brite
KEGG Orthology (KO) [BR:scr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:scr01001]
    SCHRY_v1c07740
Enzymes [BR:scr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SCHRY_v1c07740
Protein kinases [BR:scr01001]
 Serine/threonine kinases: Other
  Bacterial family
   SCHRY_v1c07740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal RIO1
Motif
Other DBs
NCBI-GeneID: 16152101
NCBI-ProteinID: AGM25350
UniProt: R4UGS7
LinkDB All DBs
Position
complement(848621..849625)
Genome map
AA seq 334 aa AA seqDB search
MGKITSGTILYERYQIIDKIADGGMAEVFEGYDLILKRYVAIKMMSVSLSKNKEAVDRFN
KEYNSIAQFSHPNVVKVYGTFEAFDRQCIVLELVRGYTLKDRLLTLGPCTNKELIYFFDA
INQAIIEAHKNDIIHRDIKPENILISYDGKIKVADFGVAILENSEDSENGKIIGTAKYMA
PEIVQSRPATKKSDLYALGIMLYELAVGVTPFVGKNPTLVAVKHVKELPLAPKLINNKIN
QVLENIILKAIAKDPSERFETVAEFNSALKVIDSQDHQHDKPIKLKNWVTIKNHRSKLQD
RYLSLPVYFSKTWVFLILALLLLAISVLLVGVFV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaataacaagtggtacgattttatatgaacgttatcaaataattgataaaatt
gctgacggaggaatggccgaagttttcgagggctatgatttaattttaaaacgttatgtg
gcaattaaaatgatgtcagttagtttatcaaaaaataaagaagctgttgatcgttttaat
aaagaatataattcaattgcccaattttctcatccaaatgttgttaaagtttatggaact
tttgaagcatttgatcgccagtgtattgttttagaactagtacggggatatacgttaaaa
gatcgtttgttaactttagggccatgtacaaataaggaactaatttatttttttgatgcc
ataaatcaagcaattattgaagcccataaaaatgacattattcaccgtgatatcaaacca
gaaaatatcctaatttcatatgatggcaaaattaaagttgctgattttggggttgctatt
ttagaaaatagtgaagatagtgaaaatggtaaaataattgggacagcaaaatatatggcc
ccagaaattgtccaatctcgtccagcaacaaaaaaaagtgacttatatgctttaggtatt
atgttatatgaattagcagttggggtaactccttttgtcggtaaaaatccaacattagta
gctgttaagcatgtaaaagaattaccattagcaccaaaattaattaataataaaattaat
caagtgttagaaaatattattctaaaagcgattgcgaaggaccctagtgaacggtttgaa
acagttgctgagtttaatagtgcattaaaagtaattgatagccaggaccatcaacatgat
aaaccaattaaattaaaaaactgggtaacaatcaaaaatcatcgtagtaaattacaagat
cgttatttatcattgccagtttattttagtaaaacatgagtatttttaattttagcgtta
cttttattggcaattagtgttttattagttggagtttttgtttaa

DBGET integrated database retrieval system