KEGG   Stanieria cyanosphaera: Sta7437_0331Help
Entry
Sta7437_0331      CDS       T02406                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00630  Glyoxylate and dicarboxylate metabolism
scs00710  Carbon fixation in photosynthetic organisms
scs01100  Metabolic pathways
scs01120  Microbial metabolism in diverse environments
scs01200  Carbon metabolism
Module
scs_M00165  Reductive pentose phosphate cycle (Calvin cycle)
scs_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
scs_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:scs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sta7437_0331
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Sta7437_0331
Enzymes [BR:scs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Sta7437_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFZ33943
UniProt: K9XN37
LinkDB All DBs
Position
complement(368132..368467)
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIAKQIDYMLEQGFIPGVEFEKEPTPELHHWTLWKLPL
FDARNAQDVLNEVRECRSEYSDCYIRVVGFDNIKQCQTVSFIVYKPNSSRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaccaaaagagcgtcgttacgaaaccctttcttatttacctcctttaacc
gatcagcaaatcgccaaacaaatcgattatatgctcgagcaaggttttattcctggagtt
gagtttgaaaaagagcctactcctgaacttcaccactggactttgtggaaattacctttg
tttgatgctagaaacgctcaagatgtacttaatgaagttagagaatgtcgctctgaatat
tctgattgctacatccgcgtagttggttttgacaacattaagcaatgtcagactgttagc
tttattgtttacaaaccaaattctagtcgttactaa

DBGET integrated database retrieval system