KEGG   Stanieria cyanosphaera: Sta7437_1277
Entry
Sta7437_1277      CDS       T02406                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00010  Glycolysis / Gluconeogenesis
scs00020  Citrate cycle (TCA cycle)
scs00620  Pyruvate metabolism
scs01100  Metabolic pathways
scs01110  Biosynthesis of secondary metabolites
scs01120  Microbial metabolism in diverse environments
scs01200  Carbon metabolism
Module
scs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sta7437_1277
   00020 Citrate cycle (TCA cycle)
    Sta7437_1277
   00620 Pyruvate metabolism
    Sta7437_1277
Enzymes [BR:scs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sta7437_1277
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Other DBs
NCBI-ProteinID: AFZ34847
UniProt: K9XT52
LinkDB
Position
complement(1416685..1417980)
AA seq 431 aa
MIHDIFMPALSSTMTEGKIVEWTKAPGDKVAKGETVVVVESDKADMDVESFNEGYLAVIL
VEAGKEAPVGNAIALLAETEAEIEEAKQKAASLQGGSSSPAAPQSKPTPVATPGAVADNA
TSTTQTTSNGRIVASPRARKLAKEFGVDLKTIQGSGPYGRIVAHDIEQAAGKTPTPTSVA
SQPVTAPVAPPPVSRPVTPSPAPVSVTPGETVPLNTLQKAVVQNMMMSLQVPTFHVNYTI
TTDALDQLYKQIKSKGVTMTALLAKAVAVTLAKHPIVNASYSEGAIKYNSEINIAVAVAM
EGGGLITPVLRNADKLDLYSLSRSWKDLVDRSRLKQLQPDEYSTGTFTLSNLGMFGVDRF
DAILPPGQGSILAVGAARPQVVANEQGLIGVKRQMVVNMTSDHRIIYGAQAASFLQDLAK
LIETEPQSLTL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgattcacgatatatttatgccggctcttagctccaccatgactgaaggaaaaattgtt
gaatggacaaaagctccaggagacaaagtagccaagggtgaaactgtggtagtggtagag
tcggataaagccgacatggatgtagagtcctttaatgaaggttatttagcggttatttta
gttgaagcaggaaaagaagcacctgtaggaaatgcgatcgctcttttagcagaaactgaa
gcagaaatcgaagaagccaaacaaaaagctgcttcactccagggaggttctagctctcct
gctgctcctcaatcaaaacctactcctgtagctactcctggtgctgttgctgacaatgca
acctctaccacccaaactacaagcaatggcagaattgtcgcttctccacgcgctagaaaa
ctagctaaagaatttggtgttgatttaaaaacaattcaaggcagtggtccctacggtaga
attgttgctcacgatatcgaacaagcagcaggtaaaactcccactcctacttcagtagca
tctcaaccagtaaccgcacctgtagcaccgcccccagtatctcgtcccgttacaccttct
ccagcacccgttagcgttactcctggtgaaactgtaccacttaatactctccaaaaagct
gtggtacagaatatgatgatgagtttgcaagtacctactttccacgtcaactacaccatc
actactgatgctttagatcaactctacaaacaaattaagtctaaaggagtaacaatgaca
gctttactcgctaaagcagtagcggttactttggcaaaacacccgatagttaatgctagc
tatagtgaaggagcaattaaatataattcagaaatcaatattgctgttgcagtagcaatg
gaaggcggaggtttaatcacacctgttttacgcaatgccgacaagcttgatctttattct
ctctctcgcagttggaaagatttagtcgaccgttctagactcaaacaactacaaccagat
gaatatagcactggtacttttaccctatctaatttaggtatgtttggcgtagatcgtttt
gatgccatcttacctcctggacaaggttcaatcctagcagttggtgctgctcgtccccaa
gtcgtagcgaatgaacaaggattaatcggtgttaaacgtcaaatggtagttaatatgacc
agcgatcatcgtattatttatggcgcacaagctgcttctttcttacaagatctagctaag
ttaattgaaacagaaccacaatctttaactctttaa

DBGET integrated database retrieval system