KEGG   Stanieria cyanosphaera: Sta7437_1277Help
Entry
Sta7437_1277      CDS       T02406                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00010  Glycolysis / Gluconeogenesis
scs00020  Citrate cycle (TCA cycle)
scs00620  Pyruvate metabolism
scs01100  Metabolic pathways
scs01110  Biosynthesis of secondary metabolites
scs01120  Microbial metabolism in diverse environments
scs01130  Biosynthesis of antibiotics
scs01200  Carbon metabolism
Module
scs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sta7437_1277
   00020 Citrate cycle (TCA cycle)
    Sta7437_1277
   00620 Pyruvate metabolism
    Sta7437_1277
Enzymes [BR:scs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sta7437_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: AFZ34847
UniProt: K9XT52
LinkDB All DBs
Position
complement(1416685..1417980)
Genome map
AA seq 431 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVEWTKAPGDKVAKGETVVVVESDKADMDVESFNEGYLAVIL
VEAGKEAPVGNAIALLAETEAEIEEAKQKAASLQGGSSSPAAPQSKPTPVATPGAVADNA
TSTTQTTSNGRIVASPRARKLAKEFGVDLKTIQGSGPYGRIVAHDIEQAAGKTPTPTSVA
SQPVTAPVAPPPVSRPVTPSPAPVSVTPGETVPLNTLQKAVVQNMMMSLQVPTFHVNYTI
TTDALDQLYKQIKSKGVTMTALLAKAVAVTLAKHPIVNASYSEGAIKYNSEINIAVAVAM
EGGGLITPVLRNADKLDLYSLSRSWKDLVDRSRLKQLQPDEYSTGTFTLSNLGMFGVDRF
DAILPPGQGSILAVGAARPQVVANEQGLIGVKRQMVVNMTSDHRIIYGAQAASFLQDLAK
LIETEPQSLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatatatttatgccggctcttagctccaccatgactgaaggaaaaattgtt
gaatggacaaaagctccaggagacaaagtagccaagggtgaaactgtggtagtggtagag
tcggataaagccgacatggatgtagagtcctttaatgaaggttatttagcggttatttta
gttgaagcaggaaaagaagcacctgtaggaaatgcgatcgctcttttagcagaaactgaa
gcagaaatcgaagaagccaaacaaaaagctgcttcactccagggaggttctagctctcct
gctgctcctcaatcaaaacctactcctgtagctactcctggtgctgttgctgacaatgca
acctctaccacccaaactacaagcaatggcagaattgtcgcttctccacgcgctagaaaa
ctagctaaagaatttggtgttgatttaaaaacaattcaaggcagtggtccctacggtaga
attgttgctcacgatatcgaacaagcagcaggtaaaactcccactcctacttcagtagca
tctcaaccagtaaccgcacctgtagcaccgcccccagtatctcgtcccgttacaccttct
ccagcacccgttagcgttactcctggtgaaactgtaccacttaatactctccaaaaagct
gtggtacagaatatgatgatgagtttgcaagtacctactttccacgtcaactacaccatc
actactgatgctttagatcaactctacaaacaaattaagtctaaaggagtaacaatgaca
gctttactcgctaaagcagtagcggttactttggcaaaacacccgatagttaatgctagc
tatagtgaaggagcaattaaatataattcagaaatcaatattgctgttgcagtagcaatg
gaaggcggaggtttaatcacacctgttttacgcaatgccgacaagcttgatctttattct
ctctctcgcagttggaaagatttagtcgaccgttctagactcaaacaactacaaccagat
gaatatagcactggtacttttaccctatctaatttaggtatgtttggcgtagatcgtttt
gatgccatcttacctcctggacaaggttcaatcctagcagttggtgctgctcgtccccaa
gtcgtagcgaatgaacaaggattaatcggtgttaaacgtcaaatggtagttaatatgacc
agcgatcatcgtattatttatggcgcacaagctgcttctttcttacaagatctagctaag
ttaattgaaacagaaccacaatctttaactctttaa

DBGET integrated database retrieval system