KEGG   Stanieria cyanosphaera: Sta7437_3615Help
Entry
Sta7437_3615      CDS       T02406                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
scs  Stanieria cyanosphaera
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 APH DUF2795
Motif
Other DBs
NCBI-ProteinID: AFZ37113
UniProt: K9XX70
LinkDB All DBs
Position
complement(4083579..4084385)
Genome map
AA seq 268 aa AA seqDB search
MENKPFHYEILRQIGQGQFSKVFCAVERQTGKLVALKELNCHNLPTKLFLRELNFLVSLH
HPNIVTFQGLDYSSNNRYLVMDYCEGGTLRDLIESQVNINKLDILKFINDILLGLEYAHS
REVVHCDLKPENVLLKPQGNSWIAKISDFGIARLFQEAGVSVVGVGATGSPAYMAPERFY
GRYSVASDLYAVGIMLYELLLGTRPFEGLPGDLIKAHLNQTITIPDSVPFILHSTIIKAL
QKLPQRRFASAEEMRKSIQLAREILSHL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaataaacctttccattacgaaattcttagacaaattggtcaaggtcaatttagt
aaagttttttgtgcagttgagcgtcaaactggtaaattagttgctctcaaagaacttaat
tgccataatttacctaccaaattatttttgcgcgaactcaactttttagttagtttgcat
catcctaatatagttacttttcaaggtttagattatagctctaataacagatatttagta
atggattattgtgaaggaggcactttaagagatttaatagaatctcaagtaaatatcaac
aaacttgatattcttaagtttattaatgatattttattaggtttagaatacgctcacagt
cgagaggtagttcactgtgacctaaaaccagagaatgttttgctcaaacctcaaggaaat
agttggattgcgaagatttctgattttggcatagctcgtttatttcaagaggctggtgtt
tcggttgtaggtgtaggagcaacaggttctcctgcttacatggctcctgaaagattttat
ggtcgttattctgttgcttccgatctttacgcggttgggattatgctttatgaattattg
cttggaacaagaccctttgaaggattaccaggagatttaatcaaagcacatctcaatcaa
accatcacaattcctgattctgttccatttatcctacactctactataattaaagctctt
caaaagttacctcaaagacgatttgcttcggccgaggaaatgcgtaaatctattcaactg
gcaagagaaattttatctcatctttga

DBGET integrated database retrieval system