KEGG   Stanieria cyanosphaera: Sta7437_3655Help
Entry
Sta7437_3655      CDS       T02406                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00970  Aminoacyl-tRNA biosynthesis
scs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sta7437_3655
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:scs03029]
    Sta7437_3655
Enzymes [BR:scs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Sta7437_3655
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Sta7437_3655
Mitochondrial biogenesis [BR:scs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Sta7437_3655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFZ37153
UniProt: K9XXA8
LinkDB All DBs
Position
4123927..4125381
Genome map
AA seq 484 aa AA seqDB search
MASIREYHQQLVSKERSAVEIATEYMQRIETLEPKVRAFLSVTADLAFSKAKQVDAKIAA
GEEIGLLEGIPTAIKDNMCTKGIKTTCGSQILANFVPPYESTVTQKLQQAGVVVVGKTNL
DEFAMGSSTENSGFQVTANPWDLERVPGGSSGGSAAAVAAAECVVALGSDTGGSIRQPAS
LCGVVGLKPTYGLVSRFGLVAYASSLDQIGPFARTVEDAAILLSAIAGYDPSDSTSLKVE
IPDYTQFLQPTLKKGLKVGIITETFGEGLDATVAATVRNAIAKLQELGAEIKEISCPRFR
YGLPAYYIIAPSEASANLARYDAVKYGLRQEADNLVGMYSTTRATGFGTEVKRRIMLGTY
ALSAGYYDAYYLKAQKVRTLIKQDFEQAFEEVDVLVCPTSPTTAFKAGEKTADPLSMYLS
DLMTIPVNLAGLPGMSIPCGFDDQGLPIGMQLIGNVLREDILFHVAHAYEQATEWHKQQP
NILS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgatacgggaataccatcaacaattggtcagtaaagaacgttctgctgtagaa
attgcaacagaatatatgcaacgcattgaaaccttagaaccaaaagtgcgagcttttttg
tctgttactgccgatttagctttctccaaagctaagcaagtagatgccaaaattgcagca
ggggaagaaattggtttgctagaaggcatcccgacagcaatcaaagataatatgtgtacc
aaaggaattaaaacaacctgcggttcgcagattttagctaattttgtgcctccttatgag
tctactgtgacccaaaagttacaacaagctggagttgtggtagtaggaaaaactaacctt
gatgagtttgcgatgggtagttctacagagaactctgggtttcaagttactgctaatcct
tgggatttagaacgagttcctggcggttcttctggtggttcggcagcagcagtagcagca
gcagaatgtgtagttgctttgggttcggatacaggaggatcgattcgtcaaccagcttct
ctgtgtggtgtggtaggattaaaaccaacttacggtttagtctctcggtttggtttggtt
gcttacgcttcttctttggatcagattggtccttttgctcgtaccgtcgaagatgcagca
attttactaagtgcgatcgcaggatacgatccttcggattctaccagtcttaaagtagaa
attcctgactatactcaatttttacaacctactctcaaaaagggtttaaaggtaggaatc
atcaccgaaacctttggtgaaggtttagatgccactgtagcagcaactgtcagaaatgcg
atcgctaaattgcaagaacttggtgcagaaatcaaagaaatttcttgtcctagattccgt
tatggtttacctgcttattatattattgctccttcagaagcatccgctaatctagctcgt
tatgatgctgttaaatatggtttacgtcaagaagcagataatttggtagggatgtattct
actactcgtgcgacgggttttggtacagaagtcaaacgtagaatcatgctaggtacttat
gctctttctgctggttactatgatgcttattatctcaaagcgcaaaaagttcgtactctg
attaagcaagattttgaacaggcatttgaggaagtagatgtgttggtatgtccgacttca
ccaactactgcgtttaaagcaggggaaaaaacagccgatcctcttagtatgtatttatct
gatttaatgactattcctgttaacttagctggactacctggaatgagtattccttgtggt
tttgatgatcaaggtttaccaattgggatgcagttgattggaaatgtattacgtgaagat
attttatttcacgttgctcatgcttacgaacaagcgactgaatggcacaaacagcaacca
aatatactcagctaa

DBGET integrated database retrieval system