KEGG   Stanieria cyanosphaera: Sta7437_4127Help
Entry
Sta7437_4127      CDS       T02406                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00970  Aminoacyl-tRNA biosynthesis
scs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sta7437_4127
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:scs03029]
    Sta7437_4127
Enzymes [BR:scs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Sta7437_4127
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Sta7437_4127
Mitochondrial biogenesis [BR:scs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Sta7437_4127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey ddrB-ParB
Motif
Other DBs
NCBI-ProteinID: AFZ37604
UniProt: K9XZZ5
LinkDB All DBs
Position
complement(4629186..4630676)
Genome map
AA seq 496 aa AA seqDB search
MTTAAPKKIEYEAIIGLETHCQLNTETKIFSSESTKFDPDNPNTNISPICLGYPGVLPVL
NEKVLEYAVKAGLALNCTIAPYSKFDRKQYFYPDLPKNYQISQFDLPIAEHGWLEIEIAE
KPNSEPIRKRIGITRLHMEEDAGKLTHGGSDRLSGSTYSLVDFNRAGIPLLEIVSEPDLR
SGKEAAEYAQELRRIMLYLGISDGKMQEGSLRCDVNISIRPVGQTEFGTKVEIKNMNSFS
AIQKAIDYEIERQIEAVENGEPIIQETRLWEEGSGRTISMRSKEGSSDYRYFPEPDLPPI
EVSNTQLETWKAELPELPASKRHRYESELGLSAYDARVLTDDRSVAEYFETAVSGGADAK
QAANWIMGDIAAYLKNSGLNITEIALKPENLAELIQLIDKGTISGKIGKDILPELLTKGG
SVQKLVESKGLIQISDTGELEKIIDEVIAANPNELAKFRSGKTNLKGFFVGQVMKKTSGR
ADPKLTNQLLDQKLPG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgactactgctgcaccgaaaaagatagaatacgaagcaatcattggcttagaaactcat
tgtcaactgaatactgaaaccaaaatctttagcagcgaatctaccaagttcgatccagat
aatcctaataccaacatctctcctatttgtttaggatatcctggggtactgcctgttttg
aatgaaaaagttctcgaatatgctgttaaagcaggtttagctcttaactgtaccattgca
ccttatagcaaatttgaccgtaaacagtatttttatcccgatttaccgaaaaattatcaa
atttcccaattcgatctgcctattgccgaacatggttggctagaaattgaaattgcggag
aaacctaattctgaaccaattagaaaaagaattggcatcactcgtctacacatggaagaa
gatgcagggaaattaactcacggaggaagtgacagactttctggttcgacttattcctta
gtagattttaatcgtgctggtattccgttgctcgaaattgtttccgaaccagatttacgt
tcgggcaaagaagcagcagaatacgctcaagaattacgtcgcattatgctttatttgggt
attagcgacggtaagatgcaagaaggttctctgcgctgcgatgtcaatatttctattcgt
cctgtcggtcaaacagaatttgggactaaagtagaaattaagaatatgaattcttttagt
gccattcaaaaagcgatcgattacgaaattgaacgtcaaatagaagcagttgaaaacggc
gaaccaattatccaagaaactcgtctgtgggaagaaggttctggacgcacaattagtatg
cgttctaaagaaggttctagtgattatcgttattttcccgaaccagatttaccaccaatt
gaagtttcaaatactcaactagaaacttggaaagcggaactaccagagttgccagcaagt
aaaagacatcgttatgagtcagaattaggattatctgcttatgatgcgagagttttaact
gacgatcgctctgtggcagaatattttgaaactgcggtaagtgggggtgcggatgccaaa
caagcagctaattggatcatgggtgatattgctgcatatttaaagaatagtggtttaaat
attacagaaattgctctcaaacctgaaaatttggctgaattaattcaattaattgacaaa
ggtactattagcggaaaaattggcaaggatatcttaccagaacttttaaccaaaggtggt
tcagttcaaaaattagtcgaaagcaagggattaattcaaatttctgatacgggagagttg
gaaaaaattattgatgaggtaatagctgctaaccccaacgaattagctaaattccgtagt
ggaaaaactaaccttaaaggtttctttgtcggacaggtgatgaagaaaaccagtggacgt
gcagatcccaaattaaccaatcaattactagaccaaaaattaccagggtaa

DBGET integrated database retrieval system