KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_0327Help
Entry
SCAT_0327         CDS       T01646                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00550  Peptidoglycan biosynthesis
sct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCAT_0327
Enzymes [BR:sct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     SCAT_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 DJ-1_PfpI GATase
Motif
Other DBs
NCBI-ProteinID: CCB73065
UniProt: F8JPL9
LinkDB All DBs
Position
390811..391539
Genome map
AA seq 242 aa AA seqDB search
MSDTSLRLVWVYPDLLSTYGDQGNALVVERRARQRGVPVTRIDVRSDQPIPTSGDIYLLG
GGEDRPQRLAAERLRRDGGLNRAVANGAIVFSVCAGYQILGTEFVNDLGRPEPGLGILDV
RSIRNEGARHVGDILGDIDPRLGLPPLSGFENHQGNTVIGPGAQPFAHLRYGNGNGTGDG
TEGAWCDTVFGTYAHGPVMARNPQIADMLLKLALDVHALPPVDEQWYDALRAERIAAASE
PA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaccagcctgcgcctggtgtgggtctaccccgacctgttgagcacctacggc
gaccagggcaacgccctggtcgtggagcgccgcgcacggcagcgcggggtgccggtgacc
cgcatcgacgtacgctccgaccagcccatccccacctccggcgacatctacctgctgggc
ggcggcgaggaccgtccgcagcggctcgccgcggaacggctgcgccgggacggcggcctc
aaccgggcggtggccaacggcgccatcgtcttctcggtctgcgccggctaccagatcctg
ggcaccgagttcgtcaacgacctcggccgccccgagccgggcctgggcatcctggacgtg
cgcagcatccgcaacgagggcgcgcggcacgtcggggacatcctgggcgacatcgacccg
cggctgggcctgccgccgctgagcggcttcgagaaccaccagggcaatacggtgatcggc
cccggcgcccagcccttcgcccacctgcggtacggcaacggcaacggcaccggggacggc
accgagggcgcctggtgcgacaccgtcttcggcacctacgcgcacggcccggtgatggcg
cgcaacccgcagatcgccgacatgctgctgaagctggcgctcgacgtgcacgccctgccg
ccggtggacgagcagtggtacgacgcgctgcgcgccgagcggatcgccgccgcctccgag
cccgcgtga

DBGET integrated database retrieval system