KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_0639Help
Entry
SCAT_0639         CDS       T01646                                 

Definition
(GenBank) putative integral membrane protein
  KO
K07058  membrane protein
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
KEGG Orthology (KO) [BR:sct00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SCAT_0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB DUF962
Motif
Other DBs
NCBI-ProteinID: CCB73377
UniProt: F8JT67
LinkDB All DBs
Position
complement(722161..723006)
Genome map
AA seq 281 aa AA seqDB search
MRWWRRLRRAWHRSRLGRFWEHGTELELLHRAMGFAALGLVTLAPLLIVVAAADPLNRRG
FALWVVDGMGLSGRPADAVERLFSAPRQVLSATSAFSVLALGLFGLAFGASVQSGYERIW
GLAAGPWHKVWRQAVWLAALAAYLYAEVQSGAVLGGGWWQGAVRITLTVVFGVAFFWWGQ
SFLLGGRIPWRALLPGAVATMAGLVGLRGFSALVFSPLIVSNAVTYGSVGAVLVVQSWLI
GVGYVVFGGALLGHHVHERHRPGGGPRPPRGGGRLPPEAGG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgcggtggtggcggcggctgcgccgcgcctggcaccgctcacgcctggggcgcttctgg
gagcacggcaccgaactggagctgctgcaccgcgcgatggggttcgccgccctcggcctg
gtcaccctggcgccgctgctcatcgtggtggcggcggccgatccgctcaaccggcgcggg
ttcgcgctgtgggtggtggacggcatggggctctccggccgcccggccgacgcggtggag
cggctgttctccgcgccccgtcaagtgctcagcgccaccagtgccttcagcgtgctggcc
ctggggctgttcggcctggccttcggggcgagcgtgcagagcggctacgaacgcatctgg
ggcctggcggcgggcccgtggcacaaggtgtggcggcaggcggtgtggctcgccgcgctc
gccgcgtacctgtacgccgaggtgcagagcggggcggtgctcggcggcggctggtggcag
ggggcggtgcggatcacgctcaccgtggtgttcggcgtcgccttcttctggtgggggcag
agcttcctgctcggcgggcggatcccgtggcgggcgctgctgccgggggcggtggcgacc
atggccgggctggtcgggctgcgtggcttctccgcgctggtcttctccccgctgatcgtc
agcaacgcggtcacctacggctcggtgggcgccgtcctggtggtgcagtcctggctgatc
ggtgtggggtacgtggtcttcggcggcgcgctgctcggccaccacgtccatgagcgccac
cggccgggcggcgggccccgcccgccccgcggcggtggccggctcccgcccgaggccggc
ggatga

DBGET integrated database retrieval system