KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_2590Help
Entry
SCAT_2590         CDS       T01646                                 

Definition
(GenBank) putative membrane protein
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG-D_C
Motif
Other DBs
NCBI-ProteinID: CCB75301
UniProt: F8K265
LinkDB All DBs
Position
2715772..2717316
Genome map
AA seq 514 aa AA seqDB search
MTPPTRTRREGGIPDGLLVFLIGFLLAVTVLVWTATGLAGLFAHGHWPDSLYFTHTPQAM
RQLVVSPKNVAAAWPDVRPADLPGPGLLWGILISELMVLLVLLGFGVGTVSRMRAVRAAR
RNAAAPPHPPAPPAPLPPPVAAPAYAAGVPSGAPAPTATGTGASEPAPTPRQPVEQAPQP
LVEQPPPTIPTGQLDGSYVLFTGHHPDRGGEAVEPVVLAAPGPVVVTCPDARLWERTAAG
RAAVGPVHLYDPEHLVDAPERLRWAPHSGCEDPSVATARARALLAPLRTHDVTANDAAAT
LLRCWLHAAAVDGLPFRQLHRWAAGSGAAEPVRILRTAREAASGWSGELEATLHAHPERR
DTAQEAVRQTLAGLNSVHIRDACTPARGDRFELESFVRDRGTLYVVGEPREDPRSRPGAM
PLLTALVSSVVEHGRRMAAGSSPGRLDPPMTCALDQVAALAPLPELPGLMGQGPALGIVT
LAVLRSQEQARHRWPTREAPSIWRTATACVTADG
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgacccctccgacgcgcacccgccgggagggcggcatcccggacggcctgctggtcttc
ctgatcggcttcctgctcgcggtgacggtcctggtgtggacggccaccgggctcgccggg
ctgttcgcccacggccactggccggactccctgtacttcacccacaccccgcaggccatg
cggcaactggtggtctcccccaagaacgtggccgccgcctggcccgacgtccgccccgcc
gacctgcccggccccggactgctgtggggcatcctcatcagtgagctgatggtcctgctg
gtactcctcggcttcggggtcggcacggtgagccggatgcgcgcggtgcgggcggcccgc
cgcaacgccgccgccccgccacatccgccggccccgcccgcgccgctgccgccgccggtg
gccgccccggcgtacgcggcgggtgtccccagcggcgccccggctccgacggcgacgggt
actggcgcatccgagcccgcgccgaccccacggcagcccgtcgaacaggcaccgcagccg
ctggtggagcaacccccgcccaccatccccaccggccaactcgacggctcctacgtgctg
ttcaccggacaccacccggaccgtggcggcgaggccgtggaaccggtggtgctggcggcc
cccggcccggtcgtcgtcacctgccccgacgcgcggctgtgggagcgtacggcggccgga
cgggcggcggtcggcccggtccacctctacgaccccgagcacctggtggacgccccggaa
cggctgcgctgggccccgcacagcggctgcgaggacccctcggtcgccaccgcccgcgcc
cgggcgctgctcgccccgttgcgcacccacgacgtcaccgccaacgacgcggcggccacc
ttgctgcgctgctggctgcacgccgccgcggtggacgggctgccgttccgccagctccac
cgctgggcggccggctcgggggcggcggaaccggtacgcatcctgcgcacggcacgggag
gcggcgtcggggtggagcggcgagctggaggcgacgctgcacgcccacccggaacgccgg
gacaccgcgcaggaggcggtgcgtcagacgctggccgggctcaactccgtgcacatcagg
gacgcttgcacgccggcgcgaggtgaccggttcgaactggaatcgttcgtgcgcgaccgg
ggaacactgtatgtggtgggcgagccgcgggaggatccgcgctcccgcccgggtgcgatg
ccgttgctgaccgcactcgtgtcaagcgtggtcgagcacggccggcgcatggccgcaggg
tcatcccccggccggctcgacccaccaatgacctgcgccctcgaccaggtcgccgcgctc
gccccgctgcccgaactccccggtctgatgggccagggccccgcgctgggcatcgtcacg
ctggccgtgctgcgctctcaggagcaggcccggcaccgctggccgacccgggaggccccg
tcgatctggcgtacggccacggcctgcgtcacggcggacggctga

DBGET integrated database retrieval system