KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_3052Help
Entry
SCAT_3052         CDS       T01646                                 

Definition
(GenBank) putative serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
KEGG Orthology (KO) [BR:sct00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sct01001]
    SCAT_3052
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SCAT_3052
Protein kinases [BR:sct01001]
 Serine/threonine kinases: Other
  Bacterial family
   SCAT_3052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: CCB75756
UniProt: F8JRA9
LinkDB All DBs
Position
complement(3206867..3208612)
Genome map
AA seq 581 aa AA seqDB search
MDQTRGSGDPEESSAHRARSYDSVELLGVGAVIGDGRYRLTRRLGRGGMAEVFAAEDVRL
GRTVAVKLLRSDLAEDPVSKKRFTREAQSVAGLNHHAVVAVYDSGEDRIGGNVVPYIVME
LCEGRTIRDLLLESEAPPVDQALVIVSGVLEALAYSHQHGIVHRDIKPANVIITDAGNVK
VMDFGIARALHGASNTMTQTGMVMGTPQYLSPEQALGKTVDHRSDLYATGCLLYELLTLR
PPFTGETPLSVVYQHVQDNPQVPSQVNGRVPPELDGLVLRSLAKDPDDRFQSAEEMLGVL
HYALRMLGERGGWTGNWDTGYVDVQAATTVLPGAAAATTALPHAAAGQTAQMRPPTLLGP
GGAEGDGGYHDGGPRGGRGGSNRGRNTVLLVLAALVAITLGVWFAVSAANPKKHEQAPAT
SVSPSVSSSSSPSTEPSASDSAGDQPTTGDQNSGDEGGSSWNNQPPSNGHHSREPSSPPP
TSGNSPSNPPADGGQHNGGTTTGSSNTGTSTGSSAGNSGTTTGSSAGNSGTSTGSSAGNS
GTSTGSSAGNSGASNGSGNAGSTVGSSAGNAGQGTLAGSNG
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggaccagacgcggggctccggcgaccctgaggagtcctcggctcaccgggcccgatcg
tacgactcggtggaactgctgggcgtgggcgcggtgatcggcgacgggcgctaccggctc
accaggcgcctcgggcgcggtggcatggccgaggtcttcgcggccgaggacgtgcgcctc
gggcgtaccgtggcggtcaagctgctccgcagcgacctcgccgaggacccggtctccaag
aagcgcttcacgcgtgaggcgcagtccgtggccgggctcaaccaccacgcggtggtcgcc
gtctacgactccggcgaggaccggatcggcggcaacgtcgtcccctacatcgtcatggag
ctgtgcgaggggcgcaccatccgcgacctgctgctggagtccgaggcacccccggtcgac
caggcgctggtcatcgtctccggggtgctggaggcgctggcctacagccaccagcacggc
atcgtgcaccgcgacatcaagcccgccaacgtgatcatcaccgacgcgggcaacgtcaag
gtgatggacttcggcatcgcccgcgccctgcacggcgcctccaacaccatgacccagacc
ggcatggtgatgggcaccccgcagtacctctccccggagcaggcgctcggcaagaccgtc
gaccaccgcagcgacctgtacgccaccggctgcctgctgtacgagctgctgacgctgcgc
ccgccgttcaccggtgagaccccgctgtcggtggtctaccagcacgtccaggacaacccg
caggtcccgtcgcaggtcaacgggcgggtgccgccggagctggacgggctggtgctgcgg
tcgctggccaaggacccggacgaccgcttccagagcgccgaggagatgctcggcgtgctc
cactacgcgctgcgcatgctgggcgagcgcggcggctggacgggcaactgggacaccggt
tacgtggacgtccaggcggccaccaccgtgctgcccggcgccgccgcggccaccacggcg
ctgccgcacgcggcggccggccagaccgcgcagatgcgtccgccgacgctgctggggccg
ggcggcgccgagggcgacggcggttaccacgacggcggtccgcgcggcggccggggcggc
agcaaccggggccgcaacaccgtgctgctggtgctggccgcgctggtggcgatcacgctc
ggcgtctggttcgcggtgtccgcggccaaccccaagaagcacgagcaggcgccggcgacc
tccgtctccccgagcgtgtcgtccagctcctcgccgagcaccgagcccagcgcgagcgac
tcggccggcgaccagccgaccaccggtgaccagaacagcggcgacgagggcggcagcagc
tggaacaaccagccgccgagcaacggccaccacagccgcgagcccagctccccgccgccc
acctccggcaacagcccctccaacccgccggccgacggcggccagcacaacggcggcacc
accaccggttcgagcaacacgggaacgtccaccggttcctccgcgggcaacagcgggacg
accaccggttcctccgcgggcaacagcggcacgtccaccggttcctccgcgggcaacagc
ggcacgtccaccggttcctccgcgggcaacagcggggcgtccaacggttccggcaacgcg
ggatcgaccgtcggcagctcggcggggaacgccggtcagggcacgctggccgggagcaac
ggctga

DBGET integrated database retrieval system