KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_4107Help
Entry
SCAT_4107         CDS       T01646                                 

Gene name
sodN
Definition
(GenBank) Superoxide dismutase [Ni]
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
KEGG Orthology (KO) [BR:sct00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCAT_4107 (sodN)
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SCAT_4107 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N DUF2254 HSR
Motif
Other DBs
NCBI-ProteinID: CCB76803
UniProt: F8JPB6
LinkDB All DBs
Position
complement(4396183..4396578)
Genome map
AA seq 131 aa AA seqDB search
MFSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAIQEKYQANEDSDFRTRAVVIKEQ
RAELAKHHVSVLWSDYFKAPHFEKYPQLHQLVNDALKALSAAKGSNDPATGQKALDLIAE
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcgcctgttcgcgcccaaggtcaaggtcagcgcccactgcgacctgccgtgc
ggcgtctacgacccggcccaggcccgtatcgaggccgagtccgtcaaggccatccaggag
aagtaccaggccaacgaggactccgacttccgcacccgcgcggtggtcatcaaggagcag
cgggccgagctggccaagcaccacgtctcggtgctgtggagcgactacttcaaggctccg
cacttcgagaagtacccgcagctgcaccagctggtcaacgacgccctcaaggccctcagc
gccgccaagggctccaacgacccggcgaccggccagaaggcgctcgacctgatcgccgag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system