KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_4843Help
Entry
SCAT_4843         CDS       T01646                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00250  Alanine, aspartate and glutamate metabolism
sct00410  beta-Alanine metabolism
sct00640  Propanoate metabolism
sct00650  Butanoate metabolism
sct01100  Metabolic pathways
sct01120  Microbial metabolism in diverse environments
Module
sct_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAT_4843
   00650 Butanoate metabolism
    SCAT_4843
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCAT_4843
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAT_4843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sct01007]
    SCAT_4843
Enzymes [BR:sct01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SCAT_4843
Amino acid related enzymes [BR:sct01007]
 Aminotransferase (transaminase)
  Class III
   SCAT_4843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CCB77531
LinkDB All DBs
Position
5215353..5216690
Genome map
AA seq 445 aa AA seqDB search
MAAMSPDSVHTALYARHRAVMPDWLATYYRAPIELTHGEGRHVQDAEGRRYLDFFGGILT
TMTAHALPEVTRAVAAQAGRVLHSSTLYLSRTAVELAERVARLSGIPDARVFFTSSGTEA
TDTALLLATAHRRSNQVLALRNSYHGRSFSAVGVTGNSAWSPTSLSPLQTYYVHGGVRTR
GPFAHLTDAEFTAACVADLEDVLGQTAGPVAALIAEPVQGVGGFTSPPDGLLAAFRRVLD
RHGILWISDEVQTGWGRTGDHFWGWQAHAQAGPPDLLTFAKGLGNGLSIGGVVARAEVMN
CLTAGSISTFGGSPVTTAGALANLTYLLEHDLQGNARRVGGLLLTRLRAVAAGSPLVREV
RGRGLMIALELVRPGTGEPWGAAATEVLEAAREGGLLLGKGGREGNVLRIAPPLTLTVAE
AEQGAAILAAALDRAGRRLDEEAVR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcagccatgagccccgacagcgtccacaccgccctgtacgcccgccaccgggccgtc
atgcccgactggctggccacctactaccgcgcccccatcgagctgacgcacggcgaggga
cgccacgtccaggacgccgagggccgccgctacctggacttcttcggcggcatcctgacc
accatgaccgcccacgcgctccccgaggtgacccgcgcggtcgccgcgcaggcgggccgc
gtcctgcactcctcgacgctctacctcagccgcaccgccgtcgaactcgccgagcgcgtc
gcacggttgtccggcatccccgacgcccgggtcttcttcacctcctccggcaccgaggcc
accgacaccgcgctgctgctggccaccgcccaccgccgctccaaccaggtgctcgcgctg
cgcaacagctaccacggccgctccttctccgcggtcggcgtcaccggcaactccgcctgg
tcgccgacgagcctgtccccgctgcagacgtactacgtgcacggcggggtgcgcacccgg
ggcccgttcgcgcatctgacggacgcggagttcaccgcggcgtgcgtggccgacctggag
gatgtgctcggccagaccgcgggtccggtggccgcgctgatcgccgaaccggtgcagggc
gtcggcgggttcaccagcccgcccgacggactgctggccgccttccgccgggtgctggac
cgccacggcatcctgtggatcagcgacgaggtgcagaccggctgggggcgcaccggcgac
cacttctgggggtggcaggcgcacgcccaggccgggccgccggatctgctcaccttcgcc
aagggcctcggcaacgggctgtccatcggcggggtggtggcccgcgccgaggtgatgaac
tgcctgaccgccggctccatctccaccttcggcggcagcccggtcaccaccgccggcgcc
ctggccaacctcacctacctgctcgaacacgacctccagggcaacgcccgccgggtcggc
ggcctgctgctcacccggctgcgggcggtcgccgccggctccccgctggtccgcgaggtc
cgtggccggggcctgatgatcgccctggaactggtgcgtcccggcaccggggaaccctgg
ggcgcggcggcgaccgaggtgctggaggcggcccgcgagggcgggctgctgctcggcaag
ggcggccgggagggcaacgtgctgcgcatcgccccgccgctcaccctgaccgtggccgag
gccgaacagggcgcggccatcctggccgccgccctggaccgggccggccgccggctcgac
gaggaggccgtccgatga

DBGET integrated database retrieval system