KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5084Help
Entry
SCAT_5084         CDS       T01646                                 

Definition
(GenBank) Succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00020  Citrate cycle (TCA cycle)
sct00190  Oxidative phosphorylation
sct00650  Butanoate metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01200  Carbon metabolism
Module
sct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sct_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAT_5084
   00650 Butanoate metabolism
    SCAT_5084
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCAT_5084
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SCAT_5084
    1.3.5.4  fumarate reductase (quinol)
     SCAT_5084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_17 Fer4_9 Fer4_10 Fer4 Fer4_18 Fer4_4 Fer4_6 Fer4_21 Fer4_2 Fer4_15 Fer4_16 Fer4_3 Fer2 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: CCB77772
UniProt: F8K1F7
LinkDB All DBs
Position
complement(5488252..5488998)
Genome map
AA seq 248 aa AA seqDB search
MRLTLRIWRQRGPEEPGAMTRYEVDGISPEMSFLEMLDTLNEELISRGEEPVAFDHDCRE
GICGACGMVINGQAHGPERTTTCQLHMRHFSDGDAIDVEPWRAAAFPVVKDLVVDRSAFD
RIIGSGGYITAPTGSAPEAHATPVPKPVADTAFEHAECIGCGACVAACPNGSAMLFTSAK
VVHLNVLPQGAPERESRVLDMVGQMDAEGFGGCTNTGECAVACPKGIPLPSIAAMNREFL
RAARKAPR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaccctgcgcatctggcgccagcgcggtcccgaggaaccgggcgccatgacc
cggtacgaggtcgacgggatctcgccggagatgtcgttcctggagatgctggacaccctc
aacgaggagctgatctcgcgtggcgaggagccggtggccttcgaccacgactgccgggag
gggatctgcggcgcgtgcggcatggtgatcaacgggcaggcgcacggcccggaacgcacc
accacctgccagttgcacatgcggcacttctccgacggtgacgccatcgacgtcgagccg
tggcgggcggcggcgttcccggtggtcaaggatctggtggtggaccgttcggcgttcgac
cggatcatcggctccggcggttacatcacggcgccgaccggcagcgcgccggaggcccat
gccacgccggtgcccaagccggtggcggacaccgcgttcgagcacgcggagtgcatcggg
tgcggcgcgtgcgtggcggcgtgtcccaacggttcggcgatgctgttcacctcggcgaag
gtggtgcatctgaacgtgctgccgcagggggcgccggagcgcgagtcgcgggtgctggac
atggtggggcagatggacgcggaggggttcggcggctgcaccaacaccggtgagtgcgcg
gtggcctgtccgaaggggatcccgttgccgtcgatcgcggcgatgaaccgggagttcctg
cgggcggcgcgcaaggcaccgcgctga

DBGET integrated database retrieval system