KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5085Help
Entry
SCAT_5085         CDS       T01646                                 

Definition
(GenBank) putative reductase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00020  Citrate cycle (TCA cycle)
sct00190  Oxidative phosphorylation
sct00650  Butanoate metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01200  Carbon metabolism
Module
sct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sct_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAT_5085
   00650 Butanoate metabolism
    SCAT_5085
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SCAT_5085
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SCAT_5085
    1.3.5.4  fumarate reductase (quinol)
     SCAT_5085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 GIDA NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCB77773
UniProt: F8K1F8
LinkDB All DBs
Position
complement(5488995..5490941)
Genome map
AA seq 648 aa AA seqDB search
MTSYTGYTVGEPIADTKAPDGPIEERWDRRRFTAKLVNPANRRKYTVIVVGTGLAGGSAG
ATLAEQGYHVVQFCYQDSPRRAHSIAAQGGINAAKNYRNDGDSVHRLFYDTVKGGDFRAR
ESNVRRLAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQVSRTFYARGQTGQQLLLG
AYQALTRQMAAGNVEMHPRTEMLDLVVVDGRARGIVARDLVTGRIDTYFADAVVLATGGY
GNVFHLSTNAKNSNATAVWRAHRRGAYFANPCFTQIHPTCIPRSGDHQSKLTLMSESLRN
DGRIWVPRTKGDTRPPAAIPEEERDYYLERIYPAFGNLVPRDIASRAAKNVCDEGRGVGP
GGQGVYLDFADAIARMGREKVAEKYGNLFEMYQRITAEDPYEVPMRIYPAIHYTMGGLWV
DYDLQTTVPGLFAIGEANFSDHGANRLGASALMQGLADGYFVLPSTIGDYLARHPHDTVD
PAHPAVTEAVSGVRERLARLLAVDGDRTPDSFHRELGELLWDDCGMARDDAGLRKALERI
PELRAEFWRRVKVPGSGDDLNQALEKANRIADYFELAELMCLDALHREESCGGHFRTESQ
TPEGEAARDDERFGYVAAWEFTGAGHAPVLHKEDLVFEYVHPTQRSYA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgtacaccggctacacggtgggcgagccgatcgccgacaccaaggccccggac
gggccgatcgaggagcgctgggaccgccggcgtttcaccgccaagctggtcaacccggcc
aaccgccgcaagtacacggtgatcgtggtcggcaccggcctggccggcggctcggccggg
gcgaccctggccgaacagggctaccacgtggtgcagttctgctaccaggactcgccgcgc
cgggcgcactccatcgccgcgcagggcggcatcaacgcggccaagaactaccgcaacgac
ggcgactcggtgcaccggctcttctacgacaccgtcaagggcggagacttccgggcgcgg
gagtccaacgtgcggcggctggcgcagatctcggtggagatcatcgaccagtgcgtggcg
cagggcgtgccgttcgcccgggagtacggcggtctgctcgacacccgttcgttcggcggg
gtgcaggtgtcgcggaccttctacgcgcgcggccagaccgggcagcagttgctgctcggc
gcctatcaggcgctgacccggcagatggcggcgggcaacgtggagatgcatccgcgcacc
gagatgctcgatctggtggtggtggacgggcgggcccggggcatcgtggcgcgggacctg
gtgaccggccggatcgacacctacttcgccgacgcggtggtgctggcgaccggtggctac
ggcaatgtcttccacctgtcgaccaacgcgaagaactccaacgcgacggccgtgtggcgg
gcgcaccggcgtggcgcgtacttcgccaacccgtgcttcacgcagatccatccgacgtgc
atcccgcgctccggcgaccaccagtcgaagctgacgctgatgagcgagtcgctccgcaac
gacgggcggatctgggtgccgaggaccaagggcgacacccgtccgccggccgcgatcccg
gaggaggagcgcgactactacctggagcggatctaccccgcgttcggcaacctggtgccg
cgggacatcgcctcgcgggcggcgaagaacgtctgcgacgagggtcgcggggtgggcccg
ggcgggcagggcgtctacctggacttcgcggacgcgatcgcgcggatgggccgggagaag
gtcgccgagaagtacggcaacctcttcgagatgtaccagcggatcaccgcggaggacccg
tacgaggtgccgatgcggatctatccggcgatccactacacgatgggcgggctgtgggtc
gactacgacctgcagaccacggtgccggggctgttcgccatcggggaggccaacttctcc
gaccacggcgccaaccggctcggggcctccgcgctgatgcaggggctcgccgacggctac
ttcgtgctgccgtccaccatcggcgactacctggcccgtcatccgcacgacaccgtcgac
ccggcgcatccggcggtcaccgaggccgtctcgggggtgcgtgagcggctggcccggctg
ctcgcggtggacggggaccgcacgccggactcgttccaccgggagctgggcgagctgctg
tgggacgactgcggcatggcgcgggacgacgcggggctgcgcaaggcgctggaacgcatc
ccggagctgcgcgcggagttctggcgccgggtgaaggtccccggcagcggtgacgacctc
aaccaggcgctggagaaggccaaccggatcgccgactacttcgagctggccgagctgatg
tgtctggacgccctgcaccgcgaggagtcgtgcggcggccacttccgtaccgagagccag
acgcccgagggcgaggcggcccgggacgacgaacgcttcggctacgtggcggcctgggag
ttcaccggggccggccacgcccccgtcctgcacaaggaagacctggtcttcgagtacgtc
caccccacccagcggagttacgcatga

DBGET integrated database retrieval system