KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5410Help
Entry
SCAT_5410         CDS       T01646                                 

Gene name
yfmT
Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00010  Glycolysis / Gluconeogenesis
sct00053  Ascorbate and aldarate metabolism
sct00071  Fatty acid degradation
sct00280  Valine, leucine and isoleucine degradation
sct00310  Lysine degradation
sct00330  Arginine and proline metabolism
sct00340  Histidine metabolism
sct00380  Tryptophan metabolism
sct00410  beta-Alanine metabolism
sct00561  Glycerolipid metabolism
sct00620  Pyruvate metabolism
sct00625  Chloroalkane and chloroalkene degradation
sct00903  Limonene and pinene degradation
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_5410 (yfmT)
   00053 Ascorbate and aldarate metabolism
    SCAT_5410 (yfmT)
   00620 Pyruvate metabolism
    SCAT_5410 (yfmT)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCAT_5410 (yfmT)
   00561 Glycerolipid metabolism
    SCAT_5410 (yfmT)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCAT_5410 (yfmT)
   00310 Lysine degradation
    SCAT_5410 (yfmT)
   00330 Arginine and proline metabolism
    SCAT_5410 (yfmT)
   00340 Histidine metabolism
    SCAT_5410 (yfmT)
   00380 Tryptophan metabolism
    SCAT_5410 (yfmT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAT_5410 (yfmT)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCAT_5410 (yfmT)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCAT_5410 (yfmT)
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SCAT_5410 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCB78098
UniProt: F8JPL1
LinkDB All DBs
Position
5823789..5825246
Genome map
AA seq 485 aa AA seqDB search
MSYSSELALQYIDGQWKSGSGSWEIIDFNPYNGEKIAAITVATVDEVDQAYRAAERAQRE
WARVNPYTRRLVFERALRILEDREAEITEAIIEELGGTRVKAGFEIGLSKDMLREAMQLA
LRAEGRILPSPVDGKENRLYRLPVGVVGVISPFNFPLFLSLKSVAPALALGNGVVLKPHQ
NTPIVGGTLIAKLFEEAGLPPGLLNVVVTDIAEIGDALIEHPVPKVISFTGSDKVGRHVA
QVAASHFKRTVLELGGNSALIVLDDADLDYAVDAAVFSRFVHQGQVCMAANRVLVDRSVE
REFSERFVAKVRTLKVGDPQDPATHIGPLINATQAGAVEAQVAGALEAGATALLRGRTEG
TLMEPSVLTGVPRDAAILGTEIFGPVVLLIPFDGEDEAVRIANDSPFGLSGAVHTADVER
GVRVAQRIETGMIHVNDGTVADEPLVAFGGEKHSGVGRLNGESTVEAFTTLKWISIQHGR
SVFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcctattcttccgaattggcgcttcaatacatcgacggccagtggaagtccggcagc
ggctcctgggagatcatcgatttcaacccctacaacggggagaaaatcgcggccataacg
gtggccacggtcgacgaggtggaccaggcgtaccgggcggccgagcgggcccagcgggaa
tgggcccgggtcaacccgtacacccggcggctggtcttcgagcgggcgctgcgcatcctg
gaggaccgggaggcggagatcaccgaggccatcatcgaggagctgggcggcacccgggtc
aaggccggcttcgagatcgggctgtcgaaggacatgctccgggaggcgatgcagctcgcg
ctgcgcgccgagggacgcatcctgccctccccggtggacggcaaggagaaccggctctac
cggctgccggtcggcgtggtcggcgtcatcagccccttcaacttcccgctcttcctctcc
ctgaagtcggtggccccggcgctggcgctgggcaacggcgtggtgctcaagccgcaccag
aacaccccgatcgtcggcggcaccctgatcgccaagctcttcgaggaggccgggctgccg
ccggggctgctcaacgtggtggtcaccgacatcgccgagatcggcgacgcgctcatcgag
cacccggtgcccaaggtgatctccttcaccggctcggacaaggtgggccgccacgtcgcc
caggtcgcggccagccacttcaagcgcaccgtgctcgaactcggcggcaacagcgcgctg
atcgtgctcgacgacgccgacctcgactacgcggtggacgccgccgtcttcagccgcttc
gtccaccagggccaggtgtgcatggcggccaaccgggtgctggtcgaccggtcggtggaa
cgggagttcagcgagcgattcgtcgccaaggtacgcaccctcaaggtcggcgacccgcag
gacccggcgacccacatcggcccgctgatcaacgccacccaggccggtgccgtcgaggcc
caggtggccggcgccctggaggccggggccaccgcgctgctgcgcgggcgtaccgagggc
accttgatggagccctcggtgctgaccggggtgccgcgggacgcggcgatcctcggcacc
gagatcttcggcccggtggtgctgctgatccccttcgacggcgaggacgaggcggtccgc
atcgccaacgactccccgttcggcctcagcggcgccgtccacaccgccgacgtcgagcgc
ggggtgcgcgtcgcgcagcgcatcgagaccggcatgatccacgtcaacgacggcacggtg
gccgacgaacccctcgtcgccttcggcggggagaagcactccggggtgggccgcctcaac
ggcgagtccacggtggaggcgttcaccacgctgaagtggatctccatccagcacgggcgc
agcgtcttcccgttctga

DBGET integrated database retrieval system