KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5459Help
Entry
SCAT_5459         CDS       T01646                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sct00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SCAT_5459
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sct03400]
    SCAT_5459
Enzymes [BR:sct01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SCAT_5459
DNA repair and recombination proteins [BR:sct03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SCAT_5459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCB78147
LinkDB All DBs
Position
5868101..5868997
Genome map
AA seq 298 aa AA seqDB search
MPDRQAVEVDGHRLVLVNLDRLLFPVSGHTKAQLLHYYAQVAEVLLPHATGRPASFVRAP
DGPGGQTWYAKRPPPGLPDWVTLAEVPGSEGPAPHVVVDSTAALMAMANLAAFEVHVPQW
TARTGPDGHDRLVLDLDPGPGADLVLCCTVAQRLRQMLADDGLTAYPVSSGSKGLHLYAP
LEPAPERAVSGYARSLAQRMQAEHPGLVTASMDRSIRPGKVFIDWSQNATHKTTACPYTL
RLHERPRVAAPVGWDEIAGCAAPERLVLSPEQVVERVARLGDPLAELAARTHAAPLPR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccggcaggccgtggaggtggacggccaccgcctggtcctcgtcaacctcgac
cggctgctcttcccggtctcgggtcacaccaaggcccagctgctgcactactacgcgcag
gtggccgaggtgctgctgccgcacgccaccggccgtcccgcctccttcgtacgcgctccg
gacggccccggcgggcagacctggtacgccaaacggcccccgccgggactgcccgactgg
gtgacgctggccgaggtgcccggcagcgaggggcccgccccgcacgtggtggtcgactcc
accgccgcgctgatggcgatggccaacctcgccgcgttcgaggtgcacgtaccgcagtgg
accgcccggaccggcccggacggccacgaccggctcgtcctcgacctcgaccccggcccc
ggcgccgacctggtgctttgctgcaccgtggcgcagcggctgcggcagatgctcgccgac
gacgggctgaccgcctatccggtctcctccggttccaagggcctccatctgtacgcgccg
ctggagcccgccccggaacgcgcggtctccggctacgcccggtcgctggcccagcggatg
caggcggagcacccggggctggtgaccgcctccatggaccgctcgatccggcccggcaag
gtcttcatcgactggtcgcagaacgccacccacaagaccaccgcctgcccctacaccctg
cgcctgcacgaacgcccgagggtggccgcaccggtcggctgggacgagatcgccggctgc
gccgccccggaacggctggtgctctccccggagcaggtggtcgaacgggtggccaggctc
ggcgatccgctggcggaactggccgcccgcacccacgcggcgccgttgccgcggtga

DBGET integrated database retrieval system