KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5513Help
Entry
SCAT_5513         CDS       T01646                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CCB78201
LinkDB All DBs
Position
complement(5927412..5928491)
Genome map
AA seq 359 aa AA seqDB search
MDLPVMPPVKPMLARLAATIPPGMSYEAKWDGFRAIVFRDGDEVELGSRTAKPLTRYFPE
VVEAVRANVPGRCVLDGEIVIARGGRLDFDALLERIHPAKSRVELLSRRTPASFVAFDIL
ALGDRSLMAAAQRDRRALLAEALAGAVHPVHIAPATTDLALAEEWFSRYEGAGLDGVVAK
PLDLPYRPDERVMVKVKHERTADCVVAGFRYHKSGPVVGSLLLGLHDAAGGLRHVGVTSA
FPMARRKALLTELEPLRMASFEGHPWAHWADPEAHTTDRMPGAPSRWSGKKDLSWIPLRP
ERVCEVAYDHMQGDRFRHTAQFRRWRPDRDPGDCTYAQLAEPVRYELADVLPPRAADAI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaccttccggtgatgccgccggtcaagccgatgctggccaggctcgcggcgacgatt
ccgcccgggatgagctacgaggccaagtgggacgggttccgggcgatcgtcttccgcgac
ggcgacgaggtggaactcggcagccgtaccgccaagccgctcacccgctacttccccgag
gtggtggaggcggtgcgggccaacgtccccgggcggtgcgtgctggacggtgagatcgtg
atcgcgcgcggcgggcggctggacttcgacgcgctgctggaacgcatccatccggcgaag
tcccgggtggagctgctgtcccgccggaccccggcctccttcgtggccttcgacatcctg
gcgctcggggaccggtcgctgatggccgccgcgcagcgcgaccgccgcgcgctgctggcc
gaggcgctggccggtgccgtccacccggtgcacatcgccccggccaccacggacctggcg
ctggccgaggagtggttcagccgttacgagggggccgggctggacggggtggtcgccaag
ccgctggatctgccgtaccggccggacgagcgggtgatggtcaaggtcaagcacgagcgg
accgccgactgcgtggtggccggcttccggtaccacaagagcggcccggtggtcggctcg
ctgctgctcgggctccacgacgcggcgggcgggctgcgccacgtgggcgtcacctcggcg
ttcccgatggcccgccgcaaggcgctgctgaccgagctggagccgttgcgcatggcgtcc
ttcgagggccatccgtgggcgcactgggccgaccccgaggcgcacaccaccgatcggatg
ccgggggcgccgagccggtggagcggcaagaaggacctgtcgtggatcccgttgcgtccg
gagcgggtctgcgaggtggcctacgaccacatgcagggcgaccggttccggcacaccgcg
cagttccgccgttggcgccccgaccgcgaccccggtgactgcacctacgcgcagttggcg
gagccggtgcgctacgagctggcggacgtgctgccgccccgggccgccgacgcgatctga

DBGET integrated database retrieval system