KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5687
Entry
SCAT_5687         CDS       T01646                                 

Gene name
cefE
Definition
(GenBank) Deacetoxycephalosporin C synthetase
  KO
K12744  deacetoxycephalosporin-C synthase [EC:1.14.20.1]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00311  Penicillin and cephalosporin biosynthesis
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
Module
sct_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SCAT_5687 (cefE)
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.1  deacetoxycephalosporin-C synthase
     SCAT_5687 (cefE)
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-ProteinID: CCB78374
LinkDB
Position
6124807..6125742
AA seq 311 aa
MDTTVPTFSLKDLQHGARQEEFRTALKDKGVFYLTDCGLTDADQQAAKDIAVDFFEHGTE
ARKRAVTSTVPTIRRGFTGLESESTARITNTGSYSDYSMCYSMGLTGNLFPTPEFESVWT
GYFHRMYDTTKEVARQVLKTTGTEPAGGVENFVDCEPLLRFRYFPEVPEDRSAEEEPLRM
APHYDLSTVTVIQQTPCPNGFVSLQSEVGGAFVDLPAKADAVLVFCGAVATLVTGGQVKA
PRHHVAAPGRDRIAGSSRTSSVFFLRPDSDFAFSVPLARRCGFDISLDGETATFKDWIEG
NYVNIRTTAQA
NT seq 936 nt   +upstreamnt  +downstreamnt
atggacaccaccgtgccgacgttcagcctgaaggacctccaacacggcgcacgacaggag
gagttccgcaccgccctgaaggacaagggcgtcttctacctgaccgactgcggcctgacc
gacgccgaccagcaggccgccaaggacatcgccgtcgacttcttcgaacacggcaccgag
gcccggaaacgcgccgtcaccagcaccgtccccaccatccgccgcggcttcaccgggctg
gagtcggagagcaccgcgcgcatcaccaacaccggcagctactccgactactcgatgtgc
tactcgatggggcttaccggcaacctcttccccacccccgagttcgaaagcgtgtggacc
ggctacttccaccgcatgtacgacacgaccaaggaagtggcccggcaggtgctgaagacc
accgggaccgaaccggcgggcggcgtggagaacttcgtcgactgcgaaccactgctgcgg
ttccgctacttcccggaggtccccgaagaccgcagcgccgaggaggaaccgctgcggatg
gcaccccactacgacctgtcgacggtgaccgtcatccagcagaccccgtgccccaacggc
ttcgtgagcctgcagagcgaggtcggcggcgccttcgtggacctgccggccaaggccgac
gccgtcctcgtcttctgcggggccgtggcgaccctggtgaccggcggccaggtgaaggca
ccgaggcaccacgtcgccgcgcccggccgggaccggatcgccggcagcagccgcacgtcc
agcgtcttcttcctgcgccccgactccgacttcgccttctccgtccccctcgccaggcgg
tgcgggttcgacatctccctcgacggcgagaccgccaccttcaaggactggatcgagggc
aactacgtcaacatccgcaccacggcccaggcatga

DBGET integrated database retrieval system