KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_p0577Help
Entry
SCAT_p0577        CDS       T01646                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00250  Alanine, aspartate and glutamate metabolism
sct00410  beta-Alanine metabolism
sct00430  Taurine and hypotaurine metabolism
sct00650  Butanoate metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct02024  Quorum sensing
Module
sct_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCAT_p0577
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCAT_p0577
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAT_p0577
   00430 Taurine and hypotaurine metabolism
    SCAT_p0577
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SCAT_p0577
Enzymes [BR:sct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SCAT_p0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCB71603
UniProt: F8JMG5
LinkDB All DBs
Position
pSCAT:complement(643114..644556)
Genome map
AA seq 480 aa AA seqDB search
MPLKHPHHQADHPGHGNRDIEVNPIFAREPLSVPRYALPSGEMEPETAYQLVHDELMLDG
NARLNLATFVSTWAEPAALRLMSECAEKNMIDKDEYPQTAELENRCVHMLARLWHAPDPR
HAVGCSTTGSSEAAMLGGLALKRRWQHRRRAEGKPADRPNLVMGVNVQICWEKFADYFEV
EPRYVPMEGDRFHLDARHAVELCDENTIGVVAVLGSTFDGSYEPVAEIAAALDDLQRRTG
LDVPVHVDGASGGMIAPFLDPDLEWDFRLPRVASINTSGHKYGLVMPGVGWALWRDADAL
PDDLVFHVNYLGGDMPTFALNFSRPGAQVVAQYYNFLRLGFDGYRRVQQTCRDVATSLAA
RIAELGPFELITDGSDIPVFAFRVRDEVDNFTVFDVSAALRERGWLVPAYTFPKNRTDLA
VLRIVVRNGFSHDLADLLLADLRRVLPRLEKQPGPYRSEEDAGGFAHGAETKNPRHPGRH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgaagcacccgcaccaccaagcggaccaccccggccacggcaaccgggacatc
gaggtcaaccccatcttcgcccgcgagccgctgagcgtcccgcgctacgcgctgccgtcc
ggcgagatggagccggagaccgcctaccaactcgtccacgacgagctgatgctggacggc
aacgcccgcctcaacctggccacgttcgtctccacctgggccgagccggccgcgctgcgg
ctgatgtccgagtgcgccgagaagaacatgatcgacaaggacgagtacccgcagaccgcg
gagctggagaaccgctgcgtccacatgctcgcccggctgtggcacgcgccggacccgcgg
cacgcggtcggctgctcgaccaccggctccagcgaggccgccatgctcggcggcctggcg
ctcaagcgccgctggcagcaccgccggcgcgcggagggcaagccggccgaccggcccaac
ctggtgatgggcgtcaacgtgcagatctgctgggagaagttcgccgactacttcgaggtc
gaaccgcgctacgtccccatggagggcgaccgcttccacctggacgcccgccacgcggtg
gagctgtgcgacgagaacaccatcggcgtcgtcgccgtcctcggctccaccttcgacggc
tcctacgaacccgtcgccgagatcgccgccgccctcgacgacctccagcggcgcaccggc
ctggacgtccccgtccacgtcgacggcgcctccggcggcatgatcgccccgttcctcgac
cccgacctggagtgggacttccggctgccccgggtcgcctcgatcaacacctccggccac
aagtacgggctggtgatgccgggcgtcggctgggcgctgtggcgggacgccgacgccctc
ccggacgacctggtgttccatgtgaactacctcggcggcgacatgccgacgttcgccctg
aacttctcccgccccggcgcccaggtggtggcccagtactacaacttcctgcggctgggg
ttcgacggctaccgccgcgtccagcagacctgccgggacgtcgccacctccctggccgcc
cggatcgccgagctgggcccgttcgagctgatcaccgacggcagcgacatcccggtcttc
gccttccgggtccgcgacgaggtcgacaacttcaccgtcttcgacgtctccgccgccctg
cgtgaacgcggctggctggtgcccgcctacaccttccccaagaaccgcaccgacctcgcc
gtgctgcgcatcgtggtgcgcaacgggttcagccacgacctcgccgacctcctcctggcc
gacctgcgccgggtgctgccccggctggagaagcaaccggggccctaccgcagcgaggag
gacgccggaggcttcgcacacggcgccgagaccaagaacccgcgccaccccggccgccat
tga

DBGET integrated database retrieval system