KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_p1189Help
Entry
SCAT_p1189        CDS       T01646                                 

Definition
(GenBank) putative zinc-binding dehydrogenase
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CCB72213
UniProt: F8JJE3
LinkDB All DBs
Position
pSCAT:1274616..1275650
Genome map
AA seq 344 aa AA seqDB search
MRAVMVTEPGAAVPTEVPDPRPGPGEVVVRVDACGLCGTDMHILDGELPSARYPLVPGHE
LAGEVVECGPGATGVAVGTRVAVDPNMPCGACHYCRIGRGNLCDDYTAVGVTRDGGFAEL
VAVPARCCHPLPEALSPAAAGLVEPLACAVHAVGRLPRRPGEHYLIYGAGTMGLMMSAVV
RHAGAASVSMVDPNEERLAFAKGFGADAVATGAGMLDRPQGFEVVIDATGVVAAIEDGLG
RVRKGGTFLQFGVADPAQAARLSPFRVYNAEIDIIGSMAVHHGFQPAIDLLAAGLDLDPL
VSDVFGLDQFDEAVAAFRAGTGRKIHIDPARRTAGPATAAEARS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtcatggtcaccgagcccggcgcagccgtcccgaccgaggtgccggatccg
cggcccgggccgggggaggtggtggtgcgggtcgacgcgtgcggcctgtgcggcaccgac
atgcacatcctggacggcgaactcccctccgcccgctacccgttggtacccggacacgaa
ctcgccggtgaggtcgtggagtgcggtccgggggccaccggggtggcggtggggacccgg
gtcgccgtcgaccccaacatgccgtgcggcgcctgccattactgccgcatcggccgcggc
aacctgtgcgacgactacaccgccgtcggcgtcacccgggacggcggcttcgccgaactg
gtcgcggtccccgcccgctgctgccacccgctccccgaggcgctctccccggccgccgcc
ggcctggtcgaaccgctcgcctgcgccgtgcacgccgtcggccggctgccccgccgcccc
ggcgagcactacctgatctacggcgccggcaccatggggctgatgatgtccgcggtggtg
cgccacgccggcgccgcctcggtctccatggtcgaccccaacgaggaacggctcgccttc
gccaaggggttcggcgccgacgccgtcgccaccggtgccgggatgctcgaccgcccccag
gggttcgaagtggtcatcgacgccaccggggtggtggccgccatcgaggacggactgggc
cgggtacgcaagggcggcaccttcctccagttcggcgtcgccgacccggcgcaggccgcc
cggctctccccgttccgggtctacaacgccgagatcgacatcatcggttcgatggccgtc
caccacggcttccagcccgccatcgacctgctcgccgccggactcgacctcgacccgctg
gtcagcgacgtcttcggactcgaccagttcgacgaggcggtggccgccttccgggccggc
accggccgcaagatacacatcgacccggcgcgccggacggccgggcccgccacggctgcg
gaggcgcggtcatga

DBGET integrated database retrieval system