KEGG   Sorangium cellulosum So0157-2: SCE1572_03840Help
Entry
SCE1572_03840     CDS       T02718                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00473  D-Alanine metabolism
scu00550  Peptidoglycan biosynthesis
scu01100  Metabolic pathways
scu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:scu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SCE1572_03840
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCE1572_03840
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SCE1572_03840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:scu01011]
    SCE1572_03840
Enzymes [BR:scu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SCE1572_03840
Peptidoglycan biosynthesis and degradation proteins [BR:scu01011]
 Precursor biosynthesis
  Amino acid ligase
   SCE1572_03840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: AGP32094
UniProt: S4XHP5
LinkDB All DBs
Position
1026347..1027489
Genome map
AA seq 380 aa AA seqDB search
MRNPAKVRVAVLFGGRSAEHEISLLSARFVVEALDRERFEPVLVGIDKSGRWLLQDEALL
LGAARDPRLARLNEAMPEIALAAHPGPAGEATLAVPGGGRSPIDVVFPVLHGPTGEDGCV
QGLLELAGVPYVGAGVLGSAVGMDKDVMKRLLRDAEIPIVPHVALRRAAWERDRGACLEQ
IAGLSPAGSGGFGPIFVKPANLGSSVGVRRVTARAELEAAVEHAFEFDLKIVCERGIEGV
REIECSVLGDDDPIASVPGEIVVGHADGFYSYAAKYIDADGATIRIPADLSPAEANAVQL
LALRTFRALEASGMARVDLFLAPDRSLYVNEINTIPGFTAISMYPKLWEASGIPPRALIE
RLIALALERGARKARLRTSA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaccccgccaaggtgcgcgtcgccgtcctgttcggcggccgatcggccgagcac
gagatctccctcctgtccgcgcgcttcgtcgtcgaggcgctcgaccgcgagcgcttcgag
ccggtgctcgtcggcatcgacaagtccggccgctggctgctccaggacgaggcgctgctc
ctcggcgccgcgcgcgacccccgcctcgcccggctgaacgaggcgatgccggagatcgcg
ctcgccgcccacccggggcccgccggcgaggcgacgctggccgtgccgggcggcgggcgc
tcgccgatcgacgtggtcttccccgtcctgcacgggcccacgggcgaggacgggtgcgtc
cagggcctcctcgagctcgccggcgtcccgtacgtcggcgccggcgtgctcggctccgcc
gtggggatggacaaggacgtgatgaagcgcctgctccgcgacgccgagatcccgatcgtg
cctcacgtcgcgctccgccgcgccgcgtgggagcgcgatcgcggcgcgtgcctcgagcag
atcgccggcctgtcccccgccgggagcggcggcttcgggccgatcttcgtcaagccggcg
aacctcgggtcgtccgtcggggtccggcgcgtcacggcgcgcgccgagctcgaggcggcc
gtcgagcacgccttcgagttcgacctgaagatcgtctgcgagcggggcatcgagggcgtg
cgcgagatcgagtgctccgtgctcggcgacgacgaccccatcgcctcggtgcccggcgag
atcgtcgtcggccacgccgacggcttctactcctacgccgcgaagtacatcgacgccgac
ggcgccacgatccgcatcccggccgatctctcgccggccgaggcgaacgccgtccagctg
ctggcgctccgcacgttccgcgcgctggaggcgtcgggcatggcccgcgtcgacctcttc
ctcgccccggaccgctcgctctacgtgaacgagatcaacaccatccccggcttcacggcg
atctcgatgtacccgaagctctgggaggcgagcggcatcccgccgcgcgcgctgatcgag
cgcctcatcgcgctcgccctcgagcgcggcgcccggaaggcccgcctgaggacgagcgcc
tag

DBGET integrated database retrieval system