KEGG   Sorangium cellulosum So0157-2: SCE1572_03975Help
Entry
SCE1572_03975     CDS       T02718                                 

Definition
(GenBank) MFS transporter
Organism
scu  Sorangium cellulosum So0157-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_3 MFS_1 MFS_2 VirC2
Motif
Other DBs
NCBI-ProteinID: AGP32096
UniProt: S4XHT3
LinkDB All DBs
Position
complement(1127356..1128639)
Genome map
AA seq 427 aa AA seqDB search
MAADLTALKPSSPLAAFESRDFRVYAAARLLATMAYQMQSVAVGFQIYDLTRDPLALGYV
GLAQFLPIAGLSLASGHAADRFDRRGILLLCYLTSSVAALALFFLARSPSPNVSAIYAVL
VLLGTVRAFQGPAGASLLPSLVPAAHFQNAATWQSTLWQVGAIGGPSVGGLLYGAWKAPA
PVYLTASLALGAASAGLLAVRARTGRMEKKPPSLATALAGLRYVYRRKVLLASISLDFVA
VFLGGAVALLPIFATDVLRVGPQGFGLLRAAPAVGAGLMAVLLAFRPIRRHAGTKMLFCV
GVFGLATVVFGLSHSFLLSLVALTVIGAADMVSVVVRMTLEQLATPPEMRGRVSAVNMVF
VGASNELGELESGTLARLIGTVPTVVVGGLGTIAVVLLWGWLFPELRAVDRLEDTRATSE
EDAAEKA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgatctcaccgccctgaagccttcgtcgcctctcgccgcctttgaatcgcgc
gatttccgcgtgtacgcggcggctcgcctgctcgccaccatggcgtaccagatgcagtcg
gtcgccgtggggtttcaaatttacgacctcacgcgcgatccgctcgcgctcggctacgtc
ggtctcgcccagttcctccccatcgcggggttgtccctcgcctccgggcacgcggcggat
cgcttcgatcggcgagggatcctccttctttgctacctcacctcgtcggtcgcggcgctc
gcgctcttcttcctcgcgcgctcgccgagcccgaacgtgtcggccatctatgccgtcctc
gtgctcctcggcacggtgcgcgccttccaggggccagccggcgcgtcgctcctgccgtcc
ctcgtgcccgcggcccacttccagaacgccgcgacgtggcagtcgacgctctggcaggtc
ggtgccatcggcggaccgagcgtcggcgggctgctctacggcgcctggaaggcgcccgcg
cccgtctacctgaccgcgagcctcgcgctcggcgcggcgtcggccggcctcctggccgtg
cgggcgcgcacggggcgcatggagaagaagccgccgtcgctcgccactgcgctcgccggg
ctgcgctacgtctaccggaggaaggtcctcctcgcgtccatctcgctcgacttcgtggcg
gtcttcctgggcggcgcggtcgcgctcttgcccatcttcgcgaccgacgtgctccgcgtc
ggtccccaggggttcggcctgctgcgcgccgcgcccgcggtgggggccgggctcatggcc
gtgctcctcgcgttccggccgatccggcgccacgccgggacgaagatgctcttctgcgtg
ggggtgttcgggctcgcgacggtcgtgttcggcctgtcgcacagcttcctgctctcgctc
gtcgcgctgaccgtcatcggcgccgccgacatggtgagcgtggtcgtgcggatgaccctg
gagcagctcgcgacgccgcccgagatgcgcggccgcgtgagcgcggtcaacatggtgttc
gtcggcgcctcgaacgagctcggagagctcgagtcgggcaccctcgcgaggctcatcggg
accgtccctaccgtggtcgtcggcggccttgggacgatcgccgtcgtgctgctctgggga
tggctgttccccgagctgcgcgcggtggacaggctcgaggacacgcgcgcgacctccgaa
gaagacgccgccgagaaggcgtga

DBGET integrated database retrieval system