KEGG   Sorangium cellulosum So0157-2: SCE1572_10110
Entry
SCE1572_10110     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:scu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SCE1572_10110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:scu03400]
    SCE1572_10110
Enzymes [BR:scu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SCE1572_10110
DNA repair and recombination proteins [BR:scu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SCE1572_10110
SSDB
Motif
Pfam: DUF4130 UDG
Other DBs
NCBI-ProteinID: AGP34838
UniProt: S4XW72
LinkDB
Position
complement(2801891..2803339)
AA seq 482 aa
MIRAPIPPTFEAFRDAARALLARHAAPEDVFWEDVVEGQGVLFDAALPALPAPASPPPRG
PSSPAPRVPAAFMSLASAAACHRDPGRFALLYRALFRLTHGEPYLLDVAADPDVARLRAL
EQAVRRDVHKMHAFVRFRRVEDAGGGERYVAWYRPDHRIVRLAAPFFERRFPSMAWSILT
PDESARWDGAELRYGPGLPRDAAPREDELEELFRTYYRAIYNPARVNLRAMRAEMPAKHW
STLPETSAMGELVRDAASRVDAMQAGRSGAASAAAAYVPGARELPVLREAAASCRACALC
ERATQTVFGEGPAGAALMLVGEQPGDEEDLCGRPFVGPAGRVLDEALSGAGLSRGGIYVT
NAVKHFKWEPRGERRLHAKPVGPEIQACRAWLQAEVEAVRPRVIVCLGATAARSFLGGRF
SVTQSRGQVFKTPWAEAWTATYHPAALLRMPDEAARAAARAHFQADLVKAASLVAGGAQG
SG
NT seq 1449 nt   +upstreamnt  +downstreamnt
gtgatccgcgcgcccatcccgccgacgttcgaggccttccgcgacgccgcccgcgcgctg
ctcgcccgccatgcggcgccggaggacgtcttctgggaagacgtggtggagggccagggc
gtcctcttcgacgcggcgctccccgcgctccccgcgccggcctccccgccgccgcgcggg
ccgtcctccccggcgccgcgcgtcccggccgcgttcatgagcctcgcgagcgccgccgct
tgccatcgcgatcccgggcggttcgcgctgctctaccgcgcgctgttccgcctgacccac
ggcgagccctacctgctcgacgtcgccgccgatcccgacgtggcgaggctgcgcgccctg
gagcaggcggtgcggcgcgacgtccacaagatgcacgcgttcgttcgcttccggcgggtc
gaggacgcgggcggcggcgagcgctacgtggcgtggtaccgcccggatcaccggatcgtg
cgcctcgccgcgccgttcttcgagcggcggttcccgtcgatggcgtggtcgatcctgacg
ccggacgagtcggcgcgctgggacggcgcggagctccgctacggcccggggctgccgcgc
gacgcggcgccgcgcgaggacgagctcgaggagctgtttcgcacgtattaccgggcgatc
tacaacccggcgcgggtgaacctccgggcgatgcgcgcggagatgccggcgaagcactgg
agcacgctgcccgagacgtcggcgatgggcgagctcgtgcgggacgcggcgtcgcgcgtc
gacgcgatgcaggcgggccgcagcggggcggcgagcgcggcggcggcgtacgtgcccggc
gcgcgcgagctcccggtgctgcgcgaggcggcggcgtcctgccgggcgtgcgcgctgtgc
gagcgggcgacgcagacggtgttcggggagggtccggcgggcgcggcgctgatgctggtg
ggggagcagccgggcgacgaggaggacctctgtgggcggccgttcgtcggccctgcgggt
cgcgtgctcgacgaggcgctctccggagcgggcctgtcgcggggcggcatctatgtgacg
aacgcggtgaagcatttcaagtgggagccgcgcggcgagcgccgtctgcacgcgaagccg
gtgggcccggagatccaggcttgtcgcgcctggctccaggcggaggtcgaggcggtgcgg
ccgcgcgtgatcgtgtgtctcggcgcgacggcggcgcgctcgttcctcggcgggcgattc
agcgtcacgcagagccgcgggcaggtcttcaagacgccgtgggccgaggcgtggacggcg
acgtaccacccggcggcgctgctgcgcatgcccgacgaggcggcccgcgcagcggcgcgg
gcgcatttccaggcagatctcgtgaaggcggcgagcttggtggcgggcggagcgcagggg
agcggataa

DBGET integrated database retrieval system