KEGG   Sorangium cellulosum So0157-2: SCE1572_13250Help
Entry
SCE1572_13250     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
Organism
scu  Sorangium cellulosum So0157-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C PP-binding KR PS-DH Aminotran_3 AMP-binding_C KAsynt_C_assoc ADH_zinc_N_2 ADH_zinc_N adh_short Thiolase_N ADH_N Epimerase GDP_Man_Dehyd ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGP35405
UniProt: S4XU45
LinkDB All DBs
Position
complement(3667004..3687901)
Genome map
AA seq 6965 aa AA seqDB search
MDYLVRLRRAAVRIKELESKALEAEQARTEPIAVVGMSCRLPGGAADLESFWQALKDGAD
EIGEIPADRWPADATPPDQPSTRWAGLLPASAIDGVDAPFFGIAPREAASMDPQQRLVLE
VAYEALEDAGHLPEQLKGSRTGVMLGVSSAEYQHHVFSAGPSHLDAYSLTGTMLSAAAGR
LSYVLGLEGPSLSVDTACSSSLVAIHLACQSLRNGESALALAGGVNVIVIPTGMQLLAQM
QAISPDGRCKTFDARANGYVRAEGCGIVVLKRLSDAQRDGDRVWALIRGSAVNQDGRSSG
LTAPNVLSQAALLRTALASAGVSPSQVGYVETHGTGTSLGDPIEVEALKAVVGAPRPDGS
TCALGAVKTNVGHLEAAAGAAGLIKAVLALNHETIPRNLHFDTLNPRISLESTSLVIPVE
ELPWKAGGAPRIAGVSSFGITGTNAHVVLEEAPRYAAATAGEASAVLLPLSAKSPEALKA
LAQAYASHLARAPAEDTASIRDIAYTASVRRSHHEHRLALVGGSLEALRASLDAFLRDEA
HACLAQGRAEPGPRPRLVFVYPGQGSQWVGMGRALLDEEPVFRAAMDACDQAIQREAGFS
LLEELRDGASASRLERIDVVQPALFAMEVALSTLWRSWGVHPDAVVGHSMGEVAAAHVAG
VLSLEDGARIVCRRSRLLRRLSGQGAMALVGLSLDRAEEALSGYEDRLSVAVSNSERSSV
LSGDPGALDEVLARLSHANVFCKRVKVDVASHSPQVDPLRSELLDALSGLAPSAATLPVY
STVTGRAREGAGFGPEYWVENLRRPVRFSQAVQRLIADGHALFLEVSPHPILLPALEEGL
DVGGQSGAALPSLRRGEEERRNLLESLGALYTRGYPVEWRRLYPNGGRCVRLPTYPWQRQ
RLWIEVARGSTAVRGAVDTGHPLLGAQLPVAGAGAVFEAVLGPSLDDHRVFGEPVVPATA
MLELARAAATRQPGSGRARVKALELTVPLVLPASGELRVQVVMSDVPAGSAAVGVYSQAA
SAPAGEAWTLHARGHVEPLPTVAEPPALDLAEARARCSAAVDVAALYAAWRDLGLDYGPA
FQGITALWQGEGEAVARVGLPAEASGSALADTACGVPPALLDAALQALSAAMPLQAKGHV
YLPVEVGEFTAWQPGATASWVYARGTSAPGPEAEVLSGDVTVLDERGGVLASVRGVRLKR
ADENALRRPRSPVPRSSLYQVAWREAAPAPDVKTPSGAWLLLAEGSALGDAVAARLRSAG
AQCTTLALHQDAALRGGELRATASRVGEALGRAVAAAAEARPQPLEGVVCLWGTSAATEA
GRSPADAAEALAAAGLAVAQALARQGAKVPSRLWWVTEGAQAVRRGEQVAAQLAPLWGLG
RVVMQEHPDLGCTLLDLEPGAEDAVEALWSEITRADEENQVAWRSGKRLAARLVEAPAAA
ALAVPDAASYRVEIAQRGLLEQLRVVAADRRAPAAGEIEIEVTASGLNFRDVLSALGMYP
GEAGPLGSECAGTVTAAGQGVEDLAPGDAVIALAPGALSRFVTVDARLAIRQPAGLSAAQ
AATVPVAFVTALYALREVGRLQPGERVLIHAAAGGVGMAAVQIAQWLGAEVLATASPPKW
AAVQGMGVRHVASSRTLAFVDDCRAATQGAGVDVVLNSLSGAFVDASAALLSPNGRFLEL
GRTDVRSAAAMTAAYPGIDYRVVDVCDVGPDHIQQMLRDIAGGLASGHLRPLPVRSFAMT
DAESAFRWMAQARHTGKVALLPAPVAPAPAIPGSSTVLITGGLGALGLHVARWLWEEHHV
QHLVLAGRRAPEGDRLAVVEALRAAGTRVTVAQADVADAAQVKALLDAIPEELPLRGVIH
AAGVLDDGVLSQQDAERFAAALAPKVRGAWNLHEQTRHVPLAFFVLFSSAASLLGPSGQS
SYAAANAFLDMLAHARRAEGLPAHSLNWGPWSGTGMAAEMDPLKQARLARRGIRGLAPEQ
ALALLGQALARPEPELCALLLDVLALRQELSSGPVPPLWRALVAPHGGRAQARAAGGWAE
QLGALAPAARAAEVEAAVRAEVAKVLSLGSAADVRTGRPFKELGLDSLMAVELRNALAAR
LRVRLPATLAFDHPTVEAMTRYLLDLLSPDRESAKPAQPSAPVALEEPIAIVGIGCRFPG
GVRDPEGFWRLLDEGVDAVEEVPKDRWDIDAFYDPDPDAAGKTISRWGGFLSTVDEFDPG
FFDVPPWEAASLDPQLRLLLEVSWEALERAGQTLERLAGSDTGVYMGICSSEYPSFADGR
AEAVDPHVFLGTAHSTGVGRLSYWLGLKGPNMPVNTACSSSLVAVHLACQALRAGECSLA
LAGGVNLILTPRGAICFSKMRALSPTGRCRAFSADADGFVRSEGCGVVVLKRLSDARRDG
DPIAAVIRGSAVNQDGRSNGLTAPSGPSQEAVIRRALAQAGVPPAAVGYVEAHGTGTPLG
DPIEVQALAKVLGEGRAGNEPVVLGSVKTNLGHTEAAAGVAALIKTALALQHRRIPRSLH
FTSPNPHVPWETLPVTVATASVPWAANGAGRIAGVSSFGFGGTNAHVVLEAAPDLEPRQE
DAPRRPLHVLALSSKAPEALREQIERYAEHLVSHPEQSLADLCYTANTGRSGFAHRWAAA
AETPEQMVAALRAAGAVLATAAPPQLQDGEPSRRPKVAFLFTGQGSQHAGMGRELYETQP
VFREALDRCDALLRPLRERSLLSVLYPKEGEPGLLHETAWAQPALFAVEYALAELWRSWG
VTPDAVLGHSVGEYAAACVAGVFSVEDGLRLMDVRGQRMQALPEGGAMASVRASSTRVAA
AIEAQADAVSIAALNGPEQVVISGADEAVRAACEALGAAGIETKRLPVAHAFHSPLVEPM
LADLEQAAASAALACPQVALVSNVTGGLVTRELMTASYWRRHAREPVRFADGIAALHAEG
IELFLEIGPRPTLLGLGEACSPDARAAWLPSLCPGQGDWPTIVKSLCHLYRSGARVDWDG
FDLPYRRRRVDAPTYPFRRSRFWISAAAHESGPPPAPRHAVDGAAPAPELPEAASCPAPD
GGATLPGAPERGARLLEEIRELFAGFFALPAAEVQADRSVLEMGLDSLGLFRFRKVIEQR
FQVTIPLSAFYEEAANLERIASLIDRTLPPEPAAVVEDRRPPPSPSSAGRAQPCSPLPPQ
EPVAPSTLRTGDEAGSAVERIVLEQLALLRPQRQGPEASGAVERIVLEQLALLRQAHDGA
GVGAPAGAACPLPPPPSSGDAPARLAPRPTREEQAPRPAATAPRREGDPATFVPYRPIRT
AREPERDAKKTAFVEALVRELTARTQGSKRLTEEHRTALANNRAVAGFRSSWKEMIYPIH
AVRAEGSRIWDVDGNEYIDVTMGFGVYLLGHAPAFVVAAVIEELRRGAPIGPMTELPSQV
AKLIIEATGVERVAFYNSGTEAVMVALRLARSITGRSKVALFGGSFHGSFDGVLAMPGLD
GPSSGAVPMAPGTTAAMVSDVMVLDYGAPDALEAIRRCGGELAAVLVEPVQSRRLDLQPR
SFLHELRRITTESGAALIFDEMINGFRIGRGGAQAHFGVRADLVTYGKVIGGGMPIGVVA
GTRRFMDAVDGGPWRFGDDSYPRVRNTFVAGTFCHHPSAMAAARQVLLHLEREGDGLQER
LTRRTAELVAELNDHCERTGAPVRLVHFGSVFRFQLKGDWELLFYRLLCKGIYVWEGRNC
FLSTAHSEEDIHRLVAAVKQSIDEMMAAGFAPAPASVPPEQPGHDSAATAAGPAVYPMSS
AQQRVYVLSQTEAGERAYHVIGAQEIVGALDEARVVACFRTLMQRHEVLRTGFDLREGGQ
LVQCVYPSVELDVTREQGSDIDAWLRQLNRPFALSRPPLFRVGLLEVGENRRILAIVLHH
LLVDGLSDAILLQEFALLYRGAALSAAPRQCHEHAAWEQEFLRSEAWAAQLRYWEERLSG
ELPRLALCTDFPRPRVRRFEGAEVCLDHPAQPLRRRAQERGTSLYMLLFAAYHALLQRLT
GQCDLVIGTAHNARQRGGFDEAVGMFANVLPLRVSIAEDATFVELLGEVKRRCLEAYEHQ
DVPFETLVQRMKAGGDPSRNPLFDAMFSYERADERRIRLPGLEINELRRPSEEAPFDLYL
DIVETRGVLRVRFEYSTALWRRETVERYAAYFRNLLGEIEGDLARSTAEAPRRRVGELSL
LTAEERRELLVAWNDTSTAYPRGLAVHEVFEAQAERTPDAIAAEHGEQQLSYRELNRRAN
QLARHLRTLGVGPEVMVGLCVERSVEMLVGLLGILKAGGAYVPLDPTYPRERLAFMMSDA
ALPVLLTHSALAGAVPRSSATVVCLDAFAVATPRESAENLGGGQGGERLAYVMYTSGSTG
RPKGVCVPHRAVVRLACATSYIRITPSDVLLQLAPISFDASTFEIWAGLLNGARVAIAPH
GPIDLADLGRTLSRHRVTTLWLTAPLFHRMVEERLDDLRGLKNLLAGGDALSAPHVRRAL
AGLPGCRLINGYGPTENTTFTCCWPVEAHALVGASVPIGRPIDNTRVYLLDARLQPVPVG
AAGELCTAGDGLARGYLGEDALTAERFVPDPFSGEPGARLYLTGDICRHRADGVIEFLGR
KDHQVKIRGHRVEPGEIEAALQLHPAVQEAAVVAREDERGDRRLTAYVVARGGAEPTATE
LRAHLQEMLPEVMIPAAFERLAAMPLDPNGKVDREALPAAAPQRRGRDDDFVAPRTPAEE
LLAGLWAEVLGVDRVGVRDSFFALGGHSLSATQLVSRIRATFGVELPLRVLFDGPTVAEL
LAYIEAARRQGAPAPPPLERAGREGELPLSFAQQRLWFLDQLKPDSPLYNIAAALRLTGP
LSAAALERSLIEIVRRHEALRTTFPAAAGAARQVIASEVRFALPVIDLGALPAAAQEDEV
RRRAQADAARPFHLGEGPLFRATLLRLSDTAHVLLWTVHHILCDGWSMGVFLAELSALYA
ALSAGRPSPLPELPIQPADHALWQRRWVSGDLLESQLAYWRRQLGGALPALELPTDRARR
AVQSYAGASLPVELPGALCTALRDLCRRQGVTLFMTLLAAFKVLLSRYAGQDDIVVGTPI
AGRTQRETEGLIGLFANTLVLRTDLSGEPTFVELLRRVREVTLDAYAHQDAPFERLVEEL
ASARDLSRSPLFQVVFVFQNMPLPALSLGDVSLSLLPVESTTAKFDLTLSLQETDGVIRG
ELEYSTDLFDAGTIARMAGHLQTLLEGLAEGPERRIGELGLLTAAERRQLVSEWNGTGVS
YAEEACLHELFEAQVERTPEAVAVVFEGQTLSYRELNRRANRLAHRLRSLGVGPEVLVGL
CVERSVEMVVGIVSILKAGGAYVPLDPSHPAERLGFMLEDARPGVLLTHSALAGRLPEHA
VTTLYLDEEGATLPAACEDNAPSRARREHLAYVMYTSGSTGKPKGTLVEHGHVVRLFRAT
ETWFGFGERDVWTLFHSYAFDFSVWEMWGALLYGGRLVVVAFEVSRCPEAFHGLLREQGV
TVLNQTPSAFRQLLVADGAYAGQPELPLRLVIFGGEALDVSSLAPWFARHGEQAPRLVNM
YGITETTVHVTYLPLSPRDAGGAGGSPIGRPLPDLQAYVLDRAGALLPIGVAGELYVGGP
GLARGYLNRPELTAERFIADPFNASPGGRLYRTGDRCRWLPDGTLEYLGRADHQVKVRGH
RVELGEIEGALRQHPAVREAIVDAREDTPGDRQLVAYVVPRGDVGHELSSCVLREHLVQK
LPAHMVPSAFILLDALPLSIHGKLDRKALPAPHRRDTTRVYVAPRTPAEELLAEIWSEVL
RLDRVGIDDPFFEIGGDSIRSLQVSTRARTAGLPLSVQQLFQHTTIRALSHALSETEGER
ADAHDLKVDPFALISAEDRARLPAGVEDAYPLAALQAGMIYHSEYSPASAMYHDVFSLHL
EAELDPSTLKASLAELSARHPVLRTSFDLVHYSQPLQLVHEAAEIPLSVEDLGALPEEVR
QARLDALFEEEKRRPFLWSEAPLLRFSLYRRGDRDQQLMMSFHHSILDGWSAASLLAELL
HRFAALAGGAARQRGGVIHAFREFVALERETLASAEAAQYWQLYLADATCSYLPRLASAG
QGGADESAPRVVGVPISAETSAALKVLASAAGVPIKSVLLAAHLRVMSLLCGQPDVVTGL
VVNGRPEMRDADRALGLFLNTVPFRQAVCHATWLDLARDVFANERRMLPYRRYPLAHLQR
HGTPLFASAFNFTHFHVYDGLDVLGVARFKDGRFFEHTNLALTAHFSLSLGRSDVELQLL
FGAPDISSAQIEAIAGYYARTLEAMARAPSAPPGAASLLSSEERCQLLSEWNDITVSYCE
PACLHELFEAQVERTPDAVAVVFGEQGLTYRALDRRANQLANHLRALGVGPESRVGLHAE
RSLDMVVGILGILKAGGAYVPLDPIYPEDRLGFMMADAALSVVLTQERLISSLADSSARV
LVLDSGWDQSGAPSDERPRSGAAPENLAYAMYTSGSTGRPKGVLVTHANVVRLLRATQRW
FNFSERDVWTMFHSFAFDVSVWEMWGALLHGGRLVVVSFEDSRAPDALHRLLRRERVTVL
CQTPSAFRQLVEFDASSPASQQLGLRAVILAGEAIDLQSLRPWFKRHGDERPQLVNMYGI
TETTVYTTYRPLRQADVDGASSSPIGRPLPDMQVYVLDPRQQLLPVGVPGELYVGGAGVA
RGYLNRPELSAERFIANPFVEQPGARLYRTGDVGRWLPDGTLEYLGRLDHQIKLHGYRIE
PGEIEAALEQHPDVQQAVVLAWQDAPGDERLVAYVVTRQGAAPPEGELRGWVRNRVPEYM
VPSAFVRLAAIPLSPNGKIDREALPAPSCARPEQQGVFIAPRTPTEELLAGLFAEVLHLD
RVGALDDFFELGGHSLSAIQLVARLRSSSGVELPLRALFEARTVERLACVIEALMDAHKV
EEFIL
NT seq 20898 nt NT seq  +upstreamnt  +downstreamnt
gtggactacctggtccgtttgaggcgtgcggcggtcaggatcaaggagctcgaatccaag
gctctcgaagccgagcaagcgaggacggagccgatcgccgtcgtcgggatgagttgccgg
ctccccggcggcgcggccgatctggagtcgttctggcaggcattgaaggacggcgccgac
gaaatcggggagatccccgcggacaggtggccggcggacgcgacgccgccggatcagccg
tcgacgcgctgggccgggctcctccccgcgtccgcgatcgacggggtggacgcgccgttc
ttcgggatcgcgcctcgcgaagcggcgagcatggacccgcagcaacggctcgtgctcgag
gtggcctacgaggcgctggaggacgccggtcatctccccgagcagctgaaggggagtcgg
acgggcgtgatgctcggcgtatcgagcgcggagtatcaacaccacgtgttctccgcgggg
ccctctcacctggacgcttattccctcaccggcacgatgctcagcgcggcggcggggcgc
ctgtcctacgtgcttgggctggaggggccgtccctctccgtcgacaccgcttgctcctca
tcgctcgtggccattcacctggcctgtcagagcctgcgcaacggcgagagcgcgctcgcc
ctggcgggcggggtcaatgtcatcgtcatcccgaccgggatgcagctcttggcgcagatg
caggcgatatcgccggacggccgctgcaagaccttcgacgcgagggccaacgggtacgtg
cgcgcggaaggctgcggcatcgtcgtcctcaagcggctctcggatgcgcagcgcgacggg
gatcgggtatgggcgttgatccggggctcagcggtcaatcaggatggccgctcctcgggg
ctgaccgcgccgaacgtgctctcacaggcggcgctgctccggaccgcgctcgcgagcgcc
ggcgtctcgccgtcccaggtgggctacgtcgagacccacggcacggggacctccctcgga
gatcccatcgaggtcgaggcgctgaaggcggtcgtgggcgcgcctcgaccggatggatcg
acctgcgcgctgggagccgtgaagacgaacgtgggtcacctcgaggcagccgcgggcgca
gcggggctgatcaaggccgtgctcgcgctcaaccacgagacgatccctcgcaacctccac
ttcgacaccctcaatccgaggatctccctcgagtccacctcgctggtcatcccggtggag
gagctgccctggaaggccggcggggcgccgcgcatcgccggggtgagctcgttcgggatc
accgggaccaacgctcatgtggtgctggaggaagcgccccgatacgcagcggcgaccgcc
ggcgaggcgtccgccgtgctcctgccgctgtcggcgaagagccctgaggcgctcaaggcg
ctggcccaggcctacgcgagccacctcgcccgcgcgcccgccgaggacacggcgagcatc
cgggatatcgcctacaccgcgagcgtgcggcggagccatcatgagcatcgcctcgcgctc
gtcgggggcagcctggaggcgctgcgcgcctcgctcgacgcgttcctccgcgacgaggct
cacgcctgtctggcgcagggacgcgctgagcccggcccccggcccaggcttgtgttcgtc
tacccgggccagggctcgcagtgggtaggcatggggcgcgcgttgctcgatgaggagccg
gtcttccgcgccgccatggacgcgtgcgatcaggcgatccagcgcgaggccggcttttcg
ctgctcgaggagctccgcgacggcgcgtccgcatcgcggctcgagcgcatcgacgtcgtc
cagccggcgctgttcgcgatggaggtggcgctctcgacgctgtggcgctcctggggagtg
caccccgacgcggtggtgggccacagcatgggcgaggtggccgccgcgcacgtcgccggc
gtcctctcgctcgaggacggggcgcgcatcgtctgccggcggagccgactgctccgccgg
ctcagcggccagggcgccatggcgctcgtgggtctgtcgctggatcgagcggaggaggcg
ctctcgggctacgaggatcggctgtcggtcgccgtcagcaacagcgagaggtcctccgtc
ctgtcgggagaccccggcgcgctcgacgaggtgctcgcgcggctctcgcacgcgaacgtg
ttctgcaagcgggtcaaggtggacgtcgcttcgcacagcccgcaggtggatccgcttcgc
agtgagctgctcgacgcgctgtcggggctcgcgccaagcgcggccacgctgcccgtctac
tcgaccgtgaccggcagggcgcgcgagggcgcggggttcggtccggagtactgggtcgag
aacctgcggcgcccggtgcggttctctcaggccgttcagcggctcatcgcggacggtcac
gcgctctttctggaggtgagcccgcacccgatcctgctgccggccctggaagaggggctg
gatgtcggcgggcagtccggggcggcgctgccgtcgctgcgccggggagaagaggagcgg
cgcaacctcctcgagtcgctgggcgccctgtacacccgcggttatccggtggagtggagg
cggctgtatccgaacggagggcggtgcgtgcggctgcccacgtacccctggcagcggcag
cggctctggatcgaggtcgcgcgcgggtcgactgcggtgcgcggcgcggtcgacaccggg
cacccgctgctcggcgcgcagctgcccgtcgcgggcgcgggcgccgtgttcgaggcggtg
ctcgggccctcgctcgacgatcaccgcgtcttcggcgagccggtcgtaccggcgacggcg
atgctcgagctcgcgcgcgcggccgcgacgaggcagcccgggtcgggccgagcgcgggtg
aaggcgctcgagctgaccgtgccgctcgtgctgccggcttcaggggagctgcgggtgcag
gtggtcatgtccgacgtgccggccgggagcgcggccgtgggggtgtacagccaggccgcc
tccgcgccggcgggcgaggcgtggaccctccacgcgagggggcatgtggagccgctcccc
acggtcgcggagccgccggcgctggatctcgccgaggcccgcgcgcgctgcagcgcggct
gtcgacgtcgcggcgctctacgcggcgtggcgcgacctggggctcgactacggtcctgcg
ttccaggggatcacggccctgtggcagggagaaggcgaggccgtcgcccgcgtcgggctg
ccggcggaggccagcggcagcgcgctcgcggacacggcgtgcggcgtgcctccggcgctc
ctcgacgcggcgctgcaggcgctgagcgccgcgatgcccctgcaggccaagggacatgtg
tacctgccggtcgaggtcggagagttcaccgcgtggcagcccggggcgacggcgtcctgg
gtctacgctcgagggacgagcgcgccgggaccggaggccgaggtgctgtcgggcgacgtt
accgtgctggacgagcgcggcggggtgctggccagtgtcaggggagtccggctcaagcgc
gccgacgagaacgcgctgcggcgaccgcggagcccggtcccgcggtcgtcgctgtaccag
gtggcctggcgggaagcggcgccggcgccggacgtcaagacgccctcgggcgcctggctc
ctgctggcggagggctcggccctcggcgacgcggtggcggcgcgcctgcgctcggcggga
gcgcagtgcacgaccttggcgctgcaccaggacgctgcgcttcggggtggagagctccgc
gccacggcctcgcgcgtcggcgaggcgctggggcgggcggtggccgccgccgcggaagcc
agaccgcagccgctggaaggcgtcgtgtgcctctggggaacgtcggccgcgacggaggca
ggacgctcgcctgccgacgccgccgaagcgctcgcggccgcggggctcgccgtggcgcag
gcactcgcgcggcagggcgcgaaggtgccgtcgcgcctgtggtgggtgaccgaaggcgcg
caggcggtgcgccggggcgagcaggtcgcggcgcagctggcgccgctctgggggctcggc
cgggtggtcatgcaggagcacccggatctcggctgcacgctcctggatctggagccgggc
gcagaggacgccgtggaggccctgtggagcgagatcacgcgggccgatgaggagaaccag
gtggcatggcggtcggggaagcgcctcgcggcgcggctggtcgaagcgcctgccgcggcg
gcgctcgcggtccccgacgcggcgtcgtacagggtggagatcgcgcaaagaggtctgctg
gaacagctgcgcgtggtcgcggcggatcgccgggcgccggcggcgggcgagatcgagatc
gaggtgaccgcctcggggctcaacttccgcgatgtcctgagcgccctggggatgtaccca
ggcgaggccgggccgctcggcagcgagtgcgcgggcaccgtcaccgccgcgggccagggt
gtggaggacctcgctccgggcgacgcggtgatcgcgcttgcgccgggcgccctcagccgg
ttcgtcaccgtggatgcgcgcctcgcgatccggcagccggcagggctctcggcagcgcag
gcggcgaccgtgcctgtcgcgttcgtgacagcgctgtacgcgctgcgcgaggtgggccgg
ctccagcccggcgagcgggtgctgatccacgccgccgccgggggcgtcgggatggccgcg
gtgcagatcgcgcagtggcttggcgccgaggtgctcgccacggcgagcccccccaagtgg
gcggcggtccaggggatgggcgtgcgccacgtggccagctcgcgcacgctggcgttcgtc
gacgactgccgcgctgcgacgcagggcgcaggggtggacgtggtgctcaactccctgagc
ggagcgttcgtcgacgcgagcgccgcgctgctgtcgccgaacggtcgcttcctcgagctg
ggcaggaccgacgtgcgatcggcggcagccatgacggcagcctatccggggatcgactac
cgggtcgtcgacgtctgcgacgtcgggccggatcacatccagcagatgctccgggacatc
gccggcggcctcgcttcaggacacctgcggccgctgccggtgcgctcgttcgcgatgacc
gacgccgaatccgcgttccggtggatggcgcaggccaggcacaccggcaaggtcgcgctc
ttgccggcccccgtcgcgccggcgccggcgatccctggcagcagcaccgtgttgatcacc
ggcgggctcggtgccctggggctgcacgtggcgcggtggctctgggaggagcaccacgtc
cagcacctcgtcctggcgggacggcgcgcgccggagggcgatcgcctcgccgtggtggag
gcgctgcgggcggcggggactcgcgtgacggtggcgcaagccgacgtcgcggacgctgcc
caggtgaaggcgctgctcgacgcgatcccggaagagctgcccctccgcggcgtgatccac
gcagcgggtgtgctggacgacggggtgctgtctcagcaggacgcggagcggttcgccgcc
gcgctcgcgcccaaggtgcgcggggcgtggaacctgcacgagcagacgcgccacgtgccg
ctcgccttcttcgtgctcttctcctcggccgcgtcgttgctcggcccgtctgggcagagc
agctacgccgccgccaatgcgttcctggacatgctggcgcacgcacggcgcgccgagggg
ctgccggcgcacagcctgaactggggcccctggtcgggaacgggcatggccgcggagatg
gatccgctgaagcaagcccgcctcgcccgccgggggatcagggggctcgcgccggagcag
gccctcgcgctgctcgggcaagcgctggcgcggcccgagcccgagctctgcgcgttgctg
ctcgacgtcctcgcgctgcggcaggagctctcctcgggccctgtgccgccgctgtggcga
gcgctcgtggcgccccacgggggacgtgcgcaggcgcgcgccgccggcggatgggccgag
cagctcggcgcgctcgcgccggcggcgcgggcggcggaggtcgaggcggcggttcgcgcc
gaggtggcgaaggtgctgtcgctcggctccgcggctgacgtgcgcaccgggcgcccgttc
aaggagctgggcctcgactcactgatggcggtggagctgcgcaacgcgctcgcagcgcgg
ctgcgggtgcggttgcctgcgacgctggcgttcgatcaccccaccgtcgaggccatgacg
cgctacctgctcgatctgttgtcgcccgaccgcgagagcgcgaagccggcgcagccgagc
gcgcccgtggcgctcgaggaaccgatagcgatcgtgggcatcggctgtcgtttcccgggc
ggcgtgcgggatccggagggcttctggcggctgctggacgagggggtggatgcggtcgag
gaggtgccgaaggaccgctgggacatcgacgcgttctacgaccccgaccccgacgcggcg
ggcaagacgatctcccgctggggaggtttcctctccacggtggacgagttcgatccgggc
ttcttcgacgtcccgccgtgggaagcggcgagcctggacccgcagctgcgtctgctcctg
gaagtgagctgggaggcgctggagcgcgcggggcagacgctggagcggctcgcgggcagc
gacaccggcgtctacatggggatatgcagcagcgagtacccgtcgttcgcggatggacgc
gctgaggcggtcgatccgcacgtgttcctggggaccgcacacagcaccggcgtggggcgc
ctctcgtactggctcgggctcaagggccccaacatgccggtcaacacggcgtgctcgtcg
tcgctcgtggccgttcacctggcgtgtcaggcgttgcgcgccggcgagtgctcgctggcg
ttggccggcggggtcaacctgatcctgacgcccaggggcgcgatctgcttcagcaagatg
cgggcgctgtcgccgaccggccgctgtcgcgccttctcggccgacgcggacggcttcgtg
cgcagcgaggggtgcggcgtcgtggtcctcaagcggctctccgacgcgaggcgagacggc
gatccgatcgcggccgtgatccgcggatcggccgtcaaccaggacggccgcagcaacggg
ctgacggcgccgagcgggccctcgcaggaggcggtgatccggcgagccctcgcgcaggca
ggcgtcccgccagcggcggtcgggtacgtggaggcgcacgggacagggacgccgctcggc
gacccgatcgaggtgcaggcgctggcgaaggtgctgggcgaaggacgcgcgggaaacgag
cccgtggtcctcggctcggtgaagacgaacctgggccacaccgaggcggcggcgggggtc
gcggccctcatcaagacggcgctcgcgctccagcatcgacgcatcccgaggtcgttgcac
ttcaccagcccgaaccctcacgtcccctgggagacgctgccggtgacggtggcgaccgcg
agcgtcccctgggcggcgaacggagcgggccggatcgccggcgtgagctcgttcgggttc
ggcgggaccaacgcccacgtcgtgctggaggcggcgccggatctcgagccgcggcaggag
gacgcgccccggcgcccgctgcacgtcctcgcgctgtcgtccaaggctcccgaggcgctg
cgggagcagatcgagcgctacgccgagcacctcgtgagccatccggagcagtcgctcgca
gacctttgctacacggccaacaccggccgcagcggcttcgcccatcgctgggcggcggcg
gcggagacaccggagcagatggtggctgccctgagggccgctggcgccgtgctcgccacg
gccgcgccgccccagctgcaggacggcgagccgtcgcggcggccgaaggtggcttttctg
ttcaccgggcagggctcgcagcacgcaggcatgggccgggagctctacgagacccagccg
gtctttcgcgaggcgctggaccgctgcgacgcgttgctcaggccgctgcgcgagcggtcg
ctcctctcggtgctgtacccgaaggagggggagcccggcctcctgcacgagaccgcctgg
gctcagcccgccttgttcgcggtggagtacgccctcgcggagctctggcgctcgtggggc
gtgacgccggacgccgtgctcggccacagcgtgggcgagtacgcggcggcctgcgtcgca
ggcgtgttctcggtggaggacgggctccggctgatggacgtgcgggggcagcggatgcag
gcgctgcccgagggcggcgcgatggcctccgtccgcgcgagctcgacccgcgtggccgcg
gcgatcgaggcccaggccgacgccgtgtcgatcgcggcgttgaacggacccgagcaggtc
gtgatctcgggcgccgacgaggcggtacgggccgcgtgcgaggcgctgggcgcggcagga
atcgagacgaagcggctccctgtggcgcacgccttccattcgcccctcgtcgagccgatg
ctcgccgacctcgagcaggcagccgcgagcgcggcgctcgcgtgtccgcaggtcgcgctc
gtctccaacgtgaccggcggcctggtcacgcgcgagctcatgaccgcctcgtactggagg
cgccacgcgcgcgagccggtgcggttcgccgatgggatcgcggcgctgcacgccgagggg
atcgagctcttcctcgagatcggcccgcgaccgacgctgctggggctcggagaggcatgc
tcgccggacgccagggcggcgtggctgccttcgctctgccccgggcaaggcgactggccg
acgatcgtgaagagcctttgccatctgtacaggagcggcgcccgcgtggactgggacggc
ttcgacctgccgtatcggcgccgacgcgtcgacgcgccaacctacccgttccgccggtcg
cggttctggatctccgcggcggcgcacgagagcgggccgccgcccgcgccgcgccatgct
gtggacggggcagctccggcgcccgagctgccggaggctgcgtcgtgccccgcgccggac
ggaggcgcaaccctgccgggcgcgccggagcggggcgcgaggctcctcgaggagatccgc
gagctcttcgccggattcttcgcgctgcccgccgcggaggtgcaggcggatcgcagcgtg
ctcgagatgggcctggactcgctcggattgttccgcttcaggaaggtgatcgagcagcgt
ttccaggtcacgatcccgctcagcgcgttctacgaagaggccgcgaacctggagcgcatc
gcgtcgctgatcgacaggacgctgccgcccgagccggccgcggtggtcgaggatcggcgc
ccgccgccctcgcccagcagcgcgggccgcgcgcagccctgctcacccctcccgccgcag
gaaccggtcgcaccgagcacgctcaggaccggagacgaggcggggagcgccgtggagcgg
atcgtcctggagcagctcgccctgctccggccgcagcgccaggggcccgaggcgagcggg
gccgtggagcggatcgtcctggagcagctcgcgctcctgcggcaggcccacgacggcgcc
ggcgtcggcgctcccgcgggcgcggcctgtccgctgcccccgccgccttcgtccggcgac
gctccggcgcgcctcgccccgcgcccgacccgggaggagcaggcgccgcgcccggccgcc
accgcgccccgacgagagggcgatccggcgaccttcgtcccctaccgcccgatccggacg
gcgcgcgagcccgagagggacgcgaagaagaccgcgttcgtggaggcgcttgtccgcgag
ctcacggcgcgcacccagggctcgaagcgcctcaccgaggagcaccgcaccgcgctcgcc
aacaaccgcgctgtggccgggttccggtcgtcctggaaggagatgatctacccgattcat
gcggtccgggccgaggggagcaggatatgggacgtcgacggcaacgagtacatcgacgtg
accatggggttcggcgtgtacctcctcgggcacgcccctgcgttcgtcgtcgcggcggtc
atcgaagagctgcgccgcggcgcgcccatcgggcccatgacggagctgccgagccaggtg
gcgaagctcatcatcgaggcgaccggcgtcgagcgggtcgccttctacaattcagggacg
gaagcggtgatggtggcgctccgcctggcgcgctccatcaccggccgttcgaaggtggcg
ctcttcggaggctcgttccacggcagcttcgacggcgtcctcgcgatgcccggcctcgac
ggcccgagctcgggcgcggtcccgatggcgcccggaacgaccgccgccatggtcagcgac
gtcatggtcctcgactacggcgcgcccgacgcgctcgaggcgatccgtcggtgcgggggc
gagctggccgccgtgctggtagagccggtgcagagccggcgcctcgacttgcagcctcgg
agcttcttgcacgagctgcggcggatcacgacggagtcgggcgcggccctcatcttcgac
gagatgatcaacgggttccggatcgggcgcggcggagctcaggcgcacttcggagttcgc
gccgacctcgtcacctacggaaaggtcatcggcggcgggatgcccatcggcgtcgtggcc
gggacacgacgcttcatggatgcggtcgacggtggtccgtggcggttcggcgacgattcc
tatccgcgggtgcggaacaccttcgtcgcggggacgttctgccaccacccgtcggcgatg
gcggcggcgcgccaggtgctgctgcacctggagcgcgagggcgacggtctgcaggagcgg
ctcacccggaggaccgcggagctcgtggcagagctcaacgaccactgcgagcgcacgggc
gccccggtccgcctcgtgcacttcggctcggtgttccgcttccagctcaagggggactgg
gagctcctcttctaccggctcctctgcaaagggatctacgtctgggaaggcagaaactgc
ttcctctccacggcccactccgaggaggacatccaccggctcgtcgccgccgtgaagcag
tcgatcgacgagatgatggcggccgggttcgcgcccgcgcccgcgtccgtgccgccagaa
cagcccggccatgacagcgcggcgacggcggccggtcccgcggtctaccccatgtcctct
gcccagcaacgggtctacgtgctcagccagacggaggccggcgagcgcgcctatcatgtc
atcggcgcccaggagatcgtcggcgccctggacgaagcgcgtgtcgtggcgtgcttccgg
acgctgatgcagcggcatgaggtcctgcgcaccgggttcgatctgcgcgagggcggccag
ctcgttcaatgcgtctacccctctgtcgagctcgacgtcacacgagagcagggcagcgat
atcgacgcatggctccggcagctcaaccggccgttcgcgctctcccgcccgccgctcttc
cgggtagggctgctcgaggtcggcgagaaccggcggatcctggcgatcgtgctgcaccac
ctgctcgtggacggcctctcggacgcgatcctgctgcaggagttcgccttgctgtaccgc
ggcgctgcgctcagcgccgcgccgcggcagtgccacgagcacgcggcctgggagcaagag
tttctgcgcagcgaggcatgggctgcgcagctcaggtactgggaagagcgcctgtccggc
gagctgccgaggctcgcgctctgcaccgacttcccgaggccgcgggtgcggcggttcgag
ggcgccgaggtctgcctcgaccaccccgcgcagccgctgcggcggcgggcacaggagcgc
ggcacgtcgctctacatgctgctcttcgcggcgtaccacgcgctcctccagcgcttgacc
gggcaatgcgatctcgtcatcggcacggcgcacaacgcccgccagcgcggcggcttcgac
gaggcggtcgggatgttcgccaacgtgctgccgctgcgggtctcgatcgccgaggacgcc
accttcgtcgagctcctcggcgaggtgaagcggcgctgcctcgaggcgtacgagcaccag
gacgtccccttcgagaccctcgtccagcgcatgaaggcgggcggagatccgagccgcaac
ccgctcttcgacgccatgttctcctacgagcgggcggacgagcggcggatccggctcccc
gggctggagatcaacgagctcaggaggccgagcgaggaggccccgttcgatctctacctg
gacatcgtcgagacgcgcggcgtgctccgcgttcgattcgagtactccacggcgctctgg
aggcgggagacagtggagcgctatgcggcgtacttccgcaacctcctcggagagatcgag
ggcgatctggcgcgctcgacggcagaggcgccgaggaggcgggtcggcgagctctcgctc
ctgaccgcggaagagcggcgcgagctgctcgtggcgtggaacgacacgagcaccgcctac
ccgcgcgggctggccgttcacgaggtcttcgaggcgcaggccgagaggacgccggacgcc
atcgcggcagagcacggggagcagcagctctcgtacagggagctgaaccgccgcgcgaac
cagctcgcgcgtcacctgcgcacgctgggggtggggcccgaggtgatggtcggtctctgc
gtcgagcggtcggtggagatgctggtcggtctcctcggcatcctcaaggcgggcggggcc
tatgtccctctcgatccgacgtatcccagggagcggctggcgttcatgatgtcggacgcg
gcgctcccggtgctgctgacgcactcggcgctcgccggcgcggtgccgcggtcctcggcc
accgtggtttgcctggacgccttcgcggtcgccaccccccgcgagagcgcggagaacctc
ggcggcggtcagggcggcgagcgccttgcctacgtgatgtacacgtctggctcgaccggt
cggcccaagggggtctgcgtcccgcatcgcgccgtggtgcggctcgcgtgcgcgaccagc
tacatccgaatcaccccgagcgatgtcttactgcagctcgcgccgatctcgttcgacgcg
tcgaccttcgagatctgggccggcctcctgaacggcgcgcgcgtggccatcgcgcctcac
ggaccgatcgatctcgccgacctcgggcggacgctttcgcgccatcgcgtgacgacgtta
tggctcaccgcgccgttgttccaccgcatggtcgaggagcgcctcgacgacctgcgcggg
ctcaagaacctcctggccggcggcgacgcgctgtcggcgccccacgtccggcgcgcgctc
gccgggctgcccggctgccggttgatcaacgggtacgggcccacggagaacaccacgttc
acctgctgctggcctgtcgaggcgcacgcgcttgtcggcgcctcggtcccgatcggccgc
cccatcgacaacacgcgcgtgtacctgctcgacgccaggcttcagcccgtccccgtcggc
gccgccggggagctctgcacggcgggcgacgggctggcgcggggctacctcggagaggat
gcgctcacggcggagaggttcgtcccggacccgttcagcggggaaccgggggcacgactg
tacctcaccggcgatatatgtcgtcatcgcgcggacggcgtgatcgagtttctgggccgc
aaggatcatcaggtgaagatccgcggccaccgcgtcgagccgggcgagattgaggcggcg
ctacagctgcatcccgcggtgcaggaggcggccgtggtggcgcgcgaggacgagcgcggg
gacaggcgcctgacggcctacgtggtggcgcgcgggggcgcggagccgaccgcgaccgag
ctacgcgcgcatctgcaggagatgctcccggaggtgatgattccggctgcgttcgagcga
ctcgcggcgatgccgctcgacccgaacggcaaggtcgaccgcgaagcactcccggccgcc
gcaccgcagcgccggggccgagacgacgacttcgtcgccccgcgcacgccggcagaagag
ctgctcgccggcctctgggccgaggtgctgggcgtcgatcgcgtcggggtgcgcgacagc
ttcttcgcgctcggcggccactcgctgtcagcgacgcagttggtctcgcggatccgcgcc
accttcggggtggagctgccgctccgggtgctgttcgacgggcccacggtggccgagctc
ctcgcgtacatcgaggccgcccggcgccaaggcgcgccggcgccgccgccgttggagcgc
gccgggcgcgaaggcgagctgccgctgtcgttcgcgcagcagcggctctggttcctggat
cagctgaagccggacagcccgctgtacaacatcgcggcggccctgcgcctcacggggccg
ctcagcgcggccgcgctcgagcggagcctcatcgagatcgtgcggcgccacgaggcgctc
cggaccacgttccccgccgccgctggagcggcgcgccaggtcatcgccagcgaggtccgc
ttcgcgctgcccgtgatcgacctcggcgcgctgccggcggcagctcaggaagacgaggtg
cggaggcgcgcgcaggccgatgccgcgcggccgttccacctcggcgaggggcctctcttc
cgggcgacgctgctgcggctctccgacacagcgcacgtccttttgtggacggtgcaccac
atcctctgtgacggctggtcgatgggggtcttcctcgccgagctgtccgcgctctacgcc
gcgctctcggccggccggccgtcgccgctacccgagctgccgatccaacccgcggatcat
gcgctctggcagcgacggtgggtctcgggcgatttgctcgagtcccagctcgcgtactgg
aggcggcagctcggcggggcgctgcccgcgctggagctgcccacggatcgagcgcggcga
gcggtgcagtcgtacgcgggagcatccctcccagtcgagctgccaggcgccctctgcacg
gcgctccgggacctctgccggcggcagggggtgacgctgttcatgaccctgctcgcggcg
ttcaaggtgctcttgtcgcgctacgcggggcaggacgacatcgtcgtcggcacgcccatc
gcgggccgcacccagcgtgagaccgaggggctgatcggcctgttcgccaatacgctggtg
ctgcgcaccgacttgtcgggagagccgacgttcgtcgagctgctccgccgggtgcgggag
gtgacgctggacgcgtatgcccaccaggacgcgccgttcgagaggctggtggaggagctc
gcatcggcgcgggatctcagccgatcgccgctgtttcaggtggtgttcgtcttccagaac
atgcccttgccggcgctgtcgctcggcgacgtgagcctgagcctgttgccggtggagagc
accaccgcgaagttcgatctcacgctctcgctccaggagacggatggcgtcatccgggga
gagctggagtattccacggacctcttcgacgcggggacgatcgcgcggatggcggggcac
ctgcagacgctgctggaagggctcgcggaagggccggagcgtcggataggggagctcggg
ctgctgacggcggcggagcggcggcagcttgtgtcggagtggaacggaacaggggtgagc
tacgcggaggaggcgtgcctccacgagctgttcgaagcgcaggtggagaggacgccggag
gcggtggcggtggtgttcgagggccagacgctctcctaccgcgagctgaaccggcgagcc
aaccggctcgcgcaccggctccggtcgctgggcgtcgggcccgaggtgctggtggggctg
tgcgtggagcggtcggtggagatggtggtggggatcgtgagcatcctcaaggctggaggg
gcgtacgtgccgctcgacccgagccatccagccgagcggctgggcttcatgctggaggac
gcgcgcccgggggtgctgctgacgcactcggcgctcgccggccggctgccggagcacgcc
gtgacgacgctgtacctcgacgaggagggcgcgacgctgccggcggcgtgcgaggacaac
gcgccgagccgagcgcggcgcgagcacctcgcctacgtcatgtacacctcgggctcgacg
ggcaagccgaagggcacgctggtggagcacggccatgtcgtccgcctgttccgtgcgacc
gagacgtggttcggcttcggcgagcgcgacgtgtggacgctcttccactcgtacgcgttc
gacttctcggtctgggagatgtggggcgcgctgctctatggcgggcgcctggtcgtggtg
gcctttgaggtgagccgctgccccgaggccttccacggcctgttgcgcgagcagggcgtg
acggtcttgaaccagacgccgtccgcgtttcgccagctcctcgtggccgacggcgcgtat
gccgggcagccggagctgccgctgcggctcgtcatcttcggcggcgaggcgctggacgtg
tcgagcctggcgccgtggttcgcgcgccacggcgagcaggccccgcggctcgtgaacatg
tacggcatcaccgagaccacggtgcatgtcacctacctgccgctcagcccccgcgacgcg
ggcggcgcgggcggcagccccatcggccgtcctctgcccgacctccaggcgtatgtgctg
gaccgggccggtgcgctgttgcccatcggcgtcgccggtgagctgtacgtcggcggcccc
gggctcgcccgcggctacctgaaccgcccggagctgaccgcagagaggttcatcgccgac
cccttcaacgcttcaccgggcgggcgcctctatcgcaccggcgaccggtgccggtggctg
cccgacggcacgctcgagtacctcggccgagcggatcatcaggtcaaggttcgcggccac
cgcgtcgagctcggcgagatcgagggcgcgctccgtcagcatccggcggtgcgagaggcc
atcgtggacgcgcgcgaggacacacccggagatcggcagctcgtggcctacgtcgtcccg
aggggcgatgtaggccacgagctgtcgtcttgcgtgctccgcgagcacctggtgcagaag
ctccccgcccacatggtcccgtccgcgttcatcctcctggacgcgctgccgctgagcatc
catggcaagctcgaccgcaaggcgctgccggccccccatcggcgcgacacgacccgcgtc
tatgtcgccccgcgcacgcccgccgaggagctgctcgccgagatctggagcgaggtgctg
cggctcgatcgcgtcgggatcgacgatcctttcttcgagatcggcggcgactcgatccgg
agcctgcaggtctcgacccgcgcacggaccgcggggctcccgctctcggtccagcagctc
ttccagcacacgacgatccgagcgctctcgcacgcgctctcggaaacggaaggagagcgc
gccgacgcgcacgacctcaaggtcgacccctttgccctgatctccgcggaggatcgggcc
cgtctgccggccggggtggaggacgcctatccgctcgccgcgcttcaagcggggatgatc
taccacagcgagtacagcccggcttcggcgatgtaccacgatgtcttcagcctgcacctc
gaggccgagctcgacccttccacgctgaaggcaagccttgccgagctctcggcgcgccac
ccggtactccgcacatcgttcgatctcgttcattacagccagccgctccagctcgtccat
gaggcggcagagatcccgctctcggtggaggacctcggggcgctcccggaggaggtgagg
caagcgaggctcgacgcgctgttcgaggaggagaaacgccggccgttcctatggtccgag
gcgccgctcttgcgcttctctctttatcggcgcggcgaccgcgaccagcagctcatgatg
agctttcatcacagcatcctcgacgggtggagtgctgcgtcgctcctggcggagctcctt
caccggttcgcggctctcgcaggcggcgccgcacgccagcgcgggggtgtaatccacgcg
ttccgggagttcgtggcgctggagcgggagacgctcgcctccgccgaggcagcgcagtac
tggcagctgtacctcgccgacgcgacctgctcgtaccttcctcgcctggcctcggccgga
cagggcggcgcagacgagagcgcgccccgggtggtaggcgtcccgatctccgccgagacg
tcggcggcgctgaaggtgctggcgagcgctgcaggcgtgccgatcaagagcgtgctgctc
gcggcgcacctccgtgtgatgagcctgctctgcggccagcccgacgtcgtgaccggtctc
gtggtcaacgggcggccggagatgcgcgacgccgatcgcgcgctcggcctcttcctcaac
accgtgccgttccggcaggcggtctgtcacgcgacgtggctcgacctcgcccgcgacgtg
ttcgcgaacgagcggcgcatgctgccataccgccgctatccgctcgcccacctgcagcgc
cacggcacgcccctcttcgcgagcgcattcaatttcacccacttccatgtgtacgacggc
ctcgacgtgctgggcgtcgcccgcttcaaggacgggcgcttcttcgagcacacgaacctc
gcgctgaccgcgcacttcagcctctctctcggccgttccgacgtggagctccagctgctc
ttcggcgcgcccgacatctcgagcgcgcagatcgaggccatcgccggatattatgcgagg
acgctcgaagccatggcccgggcgccttccgcgccgcccggcgccgcgtcgttgctctct
tcagaggagcggtgccagctgctctcggagtggaacgacatcaccgtgagctactgcgag
ccggcgtgccttcatgagctgttcgaagcccaggtggagaggacgccggatgcggtcgcg
gtggtgttcggggagcaggggctgacgtaccgagcgctcgaccggcgcgccaaccagctg
gcgaatcacctccgcgcgctgggcgtggggccggagtcgcgcgtggggctgcacgccgag
cggtcgctggacatggtggtggggatcctcggcatcctcaaggccggcggagcgtacgtg
ccgctcgacccgatctacccggaggaccgcctcgggttcatgatggctgacgccgcgctc
tcggtggtgctcacgcaagagaggctcatcagcagccttgcggacagctccgctcgggtc
cttgtcctggacagcggctgggaccagagcggggcgcccagcgacgagcgcccgcgcagc
ggggcggcgcctgagaacctcgcgtatgcgatgtacacctccggctcgaccgggcgaccc
aagggggtgctggtgacccatgccaacgtggtccggctcctgcgggcgacgcaacgctgg
ttcaacttcagcgagcgcgacgtgtggacgatgttccactccttcgccttcgacgtctcg
gtctgggagatgtggggcgcgctgctgcacggcggccggctggtggtcgtgtcgttcgag
gacagccgcgcgccggacgcgcttcaccgcctgctgcgccgcgagcgcgtgacggtgctg
tgccagacgccctcggcctttcgccagctcgtcgagttcgacgcgtccagcccagcgtca
cagcagctggggctgagggcggtcatcttggccggagaggcgatcgatctgcagagcctg
cgcccctggttcaagcgccacggcgacgagcggccgcagctcgtcaacatgtacggtatc
accgagacgacggtgtacacgacgtaccggccgctgcgccaagcggatgtggacggcgcg
tcgagcagccccattgggcgcccgctccccgacatgcaggtttacgtgctggacccgcgc
cagcagctgctgcccgtcggcgtgcccggtgagctgtacgtcggcggcgccggggtggcg
cggggctatctcaaccgtcccgagctctcggccgagcgcttcatcgcgaacccgtttgtc
gagcagcccggcgcgcggctgtacaggacgggcgatgtcggccggtggctgccagacgga
acgctggagtacctcgggcggctcgatcatcagatcaagctccacggttaccggatcgag
ccaggcgagatcgaggccgccctggagcagcaccccgacgtacagcaggccgtggtgctc
gcctggcaggatgcgccgggggacgagcggctcgtggcctacgtggtcacacgacagggc
gcagcgccgccggagggcgagctgcggggctgggtgcgcaacagggtgccagagtacatg
gtgccctctgcgttcgtgcgcctcgcggccatcccgctcagcccgaacggcaagatcgac
agggaggctctcccggcgccctcctgcgcgcgaccggagcagcagggggtgttcatcgcc
ccgcgcacgcccaccgaggagctcctggcgggcctcttcgccgaggtgctgcacctcgac
cgcgtgggcgccctcgacgacttcttcgagctcggagggcactcgctctcggccattcag
ctcgtcgcgcggcttcggtcaagctctggggtcgagctcccgctccgcgcattgttcgaa
gcgcgcacagtggagaggctcgcgtgcgtcatcgaggcgctcatggacgcgcacaaagtc
gaggagtttatcctctga

DBGET integrated database retrieval system