KEGG   Sorangium cellulosum So0157-2: SCE1572_16515Help
Entry
SCE1572_16515     CDS       T02718                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00040  Pentose and glucuronate interconversions
scu00051  Fructose and mannose metabolism
scu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCE1572_16515
   00051 Fructose and mannose metabolism
    SCE1572_16515
Enzymes [BR:scu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SCE1572_16515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N 2-Hacid_dh_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AGP35961
UniProt: S4XUF9
LinkDB All DBs
Position
4624197..4625231
Genome map
AA seq 344 aa AA seqDB search
MRATFIHGIRDVRFGEVEPPQPRDGMVMIQVAGCGICGSDLHYYLEGGIGSAQIHRAFVP
GHELAGWVVQDHPELGLSRGQLVAVDPAHSCGRCEWCQRGHVNLCPFVEFLGAPPLHGGM
TERVVVHPDQVVPVPAGFSVRRAVMLEPLGVAIHAIDLARPHLQETVVVLGCGPIGLCLV
QLARRSGAARVFAIDPVGYRAEAARRLGAHDAAPALAAVLEWTGGRGADLVLEATNSPDG
FHHAAEAARIGGRILLAGIPEGDRYALPAALCRRKGLKVKFSRRMGHVYPRAIHMVAEGA
VDVDSIVTHRFDLSDAEKGFRLQADCQDGALKSIIVPEDGGTPF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcaaccttcatccacggcatccgcgacgtccggttcggcgaggtcgagcctccg
cagccgcgcgacggcatggtgatgatccaggtcgccggctgcgggatctgcggcagcgat
ctgcattactacctggagggcgggatcggttcggcgcagatccaccgcgccttcgtgccg
ggacacgagctcgccggctgggtcgtccaggaccatccggagctgggcctgtccaggggg
cagctggtcgccgtcgaccccgcgcactcctgcggccgctgcgagtggtgccagcgcggc
cacgtgaacctgtgccccttcgtggagtttctgggcgcgccgccgctccatggcggcatg
acggagcgggtcgtcgtgcatcccgaccaggtcgtgccggtcccggcgggcttctcggtg
cgccgggcggtgatgctggagccgctcggcgtcgcgatccacgccatcgacctcgcccgg
ccccacctgcaggagacggtggtcgtgctgggctgcgggccgatcggcctgtgcctggtc
cagctcgcgcgccgctcgggcgccgcccgcgtcttcgcgatcgaccccgtgggctaccgg
gccgaggcggcgcgccgcctgggcgcgcacgacgcggcgccggcgctcgcggccgtcctg
gagtggacgggcggccggggcgccgatctcgtgctcgaggcgacgaactcgcccgacggc
ttccaccacgcggccgaagccgcgcgcatcggcgggcggatcctgctggcgggcatcccc
gagggcgaccgctacgccctgccggcggcgctgtgccgccgcaaggggctgaaggtgaag
ttctcccggcgcatggggcacgtgtacccgcgggcgatccacatggtcgccgagggcgcg
gtggacgtcgattccatcgtcacccaccgcttcgatctgtcggacgccgagaagggcttc
cgcctgcaggcggactgccaggacggggcgctgaaatcgatcatcgtcccggaggacggc
ggcaccccgttctga

DBGET integrated database retrieval system